FCRL5 BXMAS1 CD307e FCRH5 IRTA2 Membrane, Secreted (different isoforms) Low cancer specificity Detected in some Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue Detected in some Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Midbrain Olfactory bulb Pituitary gland Pons and medulla Retina Thalamus White matter Amygdala Caudate putamen Cerebellum Corpus callosum Entorhinal cortex Frontal cortex Hippocampal formation Hypothalamus Midbrain Occipital cortex Olfactory bulb Pituitary gland Pons and medulla Retina Retrosplenial and cingulate cortex Septum Somatosensory cortex Thalamus Ventral forebrain Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Olfactory bulb Pituitary gland Pons Retina Spinal cord Thalamus White matter Amygdala Caudate Cerebellum Cingulate cortex Corpus callosum Dorsal hippocampus Dorsal spinal cord Entorhinal cortex Hypothalamus Insular cortex Medulla oblongata Midbrain Motor cortex Occipital cortex Olfactory bulb Periaqueductal gray Pituitary gland Pons Prefrontal cortex Putamen Retina Retrosplenial cortex Septum Somatosensory cortex Subiculum Substantia nigra Superior colliculi Temporal cortex Thalamus Ventral hippocampus Ventral pallidum Ventral spinal cord U-266/70 U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Adaptive immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single B-cells Early spermatids Plasma cells Detected in some Plasma cells - Humoral immune response IGHD FLJ00382 FLJ46727 MGC29633 Intracellular, Membrane, Secreted (different isoforms)

approved Liver http://images.proteinatlas.org/12703/34647_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/12703/34647_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/12703/34647_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/12703/34647_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/12703/34647_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/12703/34647_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Cancer enhanced (lung cancer) Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Adaptive immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many B-cells Plasma cells T-cells Detected in some Epithelial cell types - Mixed function

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/12703/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Female 50 1176 http://images.proteinatlas.org/12703/34647_B_3_8.jpg Female 75 2042 http://images.proteinatlas.org/12703/34647_B_1_7.jpg Male 72 2178 http://images.proteinatlas.org/12703/34647_B_2_8.jpg Male 83 2360 http://images.proteinatlas.org/12703/34647_B_3_7.jpg Female 35 2587 http://images.proteinatlas.org/12703/34647_B_2_7.jpg Female 53 3482 http://images.proteinatlas.org/12703/34647_B_1_8.jpg Adrenal gland Glandular cells high strong 75%-25% cytoplasmic/membranous,nuclear Female 47 2741 http://images.proteinatlas.org/12703/34647_B_5_5.jpg Female 59 3238 http://images.proteinatlas.org/12703/34647_B_4_5.jpg Male 56 3444 http://images.proteinatlas.org/12703/34647_B_6_5.jpg Appendix Glandular cells not detected negative none none Lymphoid tissue high strong 75%-25% cytoplasmic/membranous Female 77 1896 http://images.proteinatlas.org/12703/34647_A_2_2.jpg Male 56 1993 http://images.proteinatlas.org/12703/34647_A_3_2.jpg Female 20 2444 http://images.proteinatlas.org/12703/34647_A_1_2.jpg Bone marrow Hematopoietic cells not detected weak <25% cytoplasmic/membranous Female 64 3435 http://images.proteinatlas.org/12703/34647_B_4_4.jpg Breast Adipocytes not detected negative none none Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 23 2773 http://images.proteinatlas.org/12703/34647_B_1_4.jpg Female 59 2805 http://images.proteinatlas.org/12703/34647_B_3_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Male 71 2231 http://images.proteinatlas.org/12703/34647_B_4_2.jpg Female 54 2393 http://images.proteinatlas.org/12703/34647_B_5_2.jpg Male 77 3404 http://images.proteinatlas.org/12703/34647_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/12703/34647_B_9_7.jpg Female 54 2523 http://images.proteinatlas.org/12703/34647_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/12703/34647_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/12703/34647_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/12703/34647_B_9_8.jpg Female 19 2524 http://images.proteinatlas.org/12703/34647_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Neuropil not detected negative none none Female 30 1582 http://images.proteinatlas.org/12703/34647_B_8_5.jpg Male 45 2521 http://images.proteinatlas.org/12703/34647_B_7_5.jpg Male 57 2927 http://images.proteinatlas.org/12703/34647_B_9_5.jpg Cervix Glandular cells not detected negative none none Squamous epithelial cells not detected negative none none Female 55 2005 http://images.proteinatlas.org/12703/34647_B_8_3.jpg Female 65 2434 http://images.proteinatlas.org/12703/34647_B_7_3.jpg Female 39 3313 http://images.proteinatlas.org/12703/34647_B_9_3.jpg Colon Endothelial cells not detected negative none none Glandular cells not detected negative none none Peripheral nerve/ganglion not detected negative none none Female 56 1423 http://images.proteinatlas.org/12703/34647_A_7_3.jpg Female 80 2944 http://images.proteinatlas.org/12703/34647_A_9_3.jpg Male 73 3266 http://images.proteinatlas.org/12703/34647_A_8_3.jpg Duodenum Glandular cells not detected negative none none Male 50 1904 http://images.proteinatlas.org/12703/34647_A_7_2.jpg Male 54 2562 http://images.proteinatlas.org/12703/34647_A_9_2.jpg Female 71 3004 http://images.proteinatlas.org/12703/34647_A_8_2.jpg Endometrium 1 Cells in endometrial stroma medium moderate 75%-25% cytoplasmic/membranous Glandular cells low moderate <25% cytoplasmic/membranous Female 42 2242 http://images.proteinatlas.org/12703/34647_B_5_3.jpg Female 33 2941 http://images.proteinatlas.org/12703/34647_B_6_3.jpg Female 39 3313 http://images.proteinatlas.org/12703/34647_B_4_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells not detected weak <25% cytoplasmic/membranous Female 50 1658 http://images.proteinatlas.org/12703/34647_B_2_3.jpg Female 50 2206 http://images.proteinatlas.org/12703/34647_B_1_3.jpg Female 51 3491 http://images.proteinatlas.org/12703/34647_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 46 589 http://images.proteinatlas.org/12703/34647_A_2_6.jpg Male 36 1740 http://images.proteinatlas.org/12703/34647_A_3_6.jpg Male 56 3355 http://images.proteinatlas.org/12703/34647_A_1_6.jpg Esophagus Squamous epithelial cells not detected negative none none Female 72 2794 http://images.proteinatlas.org/12703/34647_B_4_1.jpg Male 48 3044 http://images.proteinatlas.org/12703/34647_B_6_1.jpg Male 54 3197 http://images.proteinatlas.org/12703/34647_B_5_1.jpg Fallopian tube Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 23 2138 http://images.proteinatlas.org/12703/34647_A_7_7.jpg Female 34 2382 http://images.proteinatlas.org/12703/34647_A_8_7.jpg Female 32 2447 http://images.proteinatlas.org/12703/34647_A_9_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Female 64 2025 http://images.proteinatlas.org/12703/34647_A_5_4.jpg Female 26 2446 http://images.proteinatlas.org/12703/34647_A_4_4.jpg Male 54 2562 http://images.proteinatlas.org/12703/34647_A_6_4.jpg Heart muscle Cardiomyocytes medium moderate >75% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/12703/34647_B_4_6.jpg Female 54 2523 http://images.proteinatlas.org/12703/34647_B_5_6.jpg Female 19 2524 http://images.proteinatlas.org/12703/34647_B_6_6.jpg Hippocampus Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/12703/34647_B_9_6.jpg Female 54 2523 http://images.proteinatlas.org/12703/34647_B_8_6.jpg Female 19 2524 http://images.proteinatlas.org/12703/34647_B_7_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 16 1767 http://images.proteinatlas.org/12703/34647_A_8_5.jpg Female 56 1933 http://images.proteinatlas.org/12703/34647_A_9_5.jpg Male 59 3229 http://images.proteinatlas.org/12703/34647_A_7_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 55 2429 http://images.proteinatlas.org/12703/34647_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/12703/34647_A_9_4.jpg Male 73 3378 http://images.proteinatlas.org/12703/34647_A_7_4.jpg Lung Alveolar cells not detected weak <25% cytoplasmic/membranous Macrophages low weak >75% cytoplasmic/membranous Male 21 2101 http://images.proteinatlas.org/12703/34647_A_1_4.jpg Male 59 2222 http://images.proteinatlas.org/12703/34647_A_3_4.jpg Female 49 2268 http://images.proteinatlas.org/12703/34647_A_2_4.jpg Lymph node Germinal center cells high strong >75% cytoplasmic/membranous Non-germinal center cells not detected negative none none Male 55 1724 http://images.proteinatlas.org/12703/34647_A_7_8.jpg Male 33 3267 http://images.proteinatlas.org/12703/34647_A_8_8.jpg Female 53 3285 http://images.proteinatlas.org/12703/34647_A_9_8.jpg Nasopharynx Respiratory epithelial cells not detected negative none none Male 48 2402 http://images.proteinatlas.org/12703/34647_B_8_2.jpg Male 21 2688 http://images.proteinatlas.org/12703/34647_B_9_2.jpg Male 22 3362 http://images.proteinatlas.org/12703/34647_B_7_2.jpg Oral mucosa Squamous epithelial cells not detected negative none none Female 84 2406 http://images.proteinatlas.org/12703/34647_A_9_1.jpg Female 62 2550 http://images.proteinatlas.org/12703/34647_A_8_1.jpg Male 58 3135 http://images.proteinatlas.org/12703/34647_A_7_1.jpg Ovary Follicle cells not detected weak <25% cytoplasmic/membranous Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/12703/34647_A_5_7.jpg Female 33 2159 http://images.proteinatlas.org/12703/34647_A_4_7.jpg Female 41 2713 http://images.proteinatlas.org/12703/34647_A_6_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/12703/34647_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/12703/34647_A_1_3.jpg Female 70 3320 http://images.proteinatlas.org/12703/34647_A_2_3.jpg Parathyroid gland Glandular cells low moderate <25% cytoplasmic/membranous Female 86 3176 http://images.proteinatlas.org/12703/34647_A_2_8.jpg Female 47 3511 http://images.proteinatlas.org/12703/34647_A_3_8.jpg Female 74 3513 http://images.proteinatlas.org/12703/34647_A_1_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected negative none none Female 18 2390 http://images.proteinatlas.org/12703/34647_A_2_7.jpg Female 30 2515 http://images.proteinatlas.org/12703/34647_A_1_7.jpg Female 30 2903 http://images.proteinatlas.org/12703/34647_A_3_7.jpg Prostate Glandular cells not detected negative none none Male 51 2053 http://images.proteinatlas.org/12703/34647_A_3_5.jpg Male 60 2098 http://images.proteinatlas.org/12703/34647_A_2_5.jpg Male 76 2932 http://images.proteinatlas.org/12703/34647_A_1_5.jpg Rectum Glandular cells not detected negative none none Female 66 2060 http://images.proteinatlas.org/12703/34647_A_5_3.jpg Male 44 3231 http://images.proteinatlas.org/12703/34647_A_4_3.jpg Female 24 3364 http://images.proteinatlas.org/12703/34647_A_6_3.jpg Salivary gland Glandular cells not detected negative none none Male 63 1845 http://images.proteinatlas.org/12703/34647_B_1_1.jpg Male 62 2367 http://images.proteinatlas.org/12703/34647_B_2_1.jpg Male 3 2405 http://images.proteinatlas.org/12703/34647_B_3_1.jpg Seminal vesicle Glandular cells low moderate <25% cytoplasmic/membranous Male 64 1938 http://images.proteinatlas.org/12703/34647_A_9_6.jpg Male 46 3186 http://images.proteinatlas.org/12703/34647_A_7_6.jpg Male 68 3297 http://images.proteinatlas.org/12703/34647_A_8_6.jpg Skeletal muscle Myocytes low weak 75%-25% cytoplasmic/membranous Male 83 2360 http://images.proteinatlas.org/12703/34647_B_2_6.jpg Female 84 2406 http://images.proteinatlas.org/12703/34647_B_1_6.jpg Male 51 2608 http://images.proteinatlas.org/12703/34647_B_3_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected weak <25% cytoplasmic/membranous Langerhans not detected negative none none Melanocytes not detected negative none none Female 17 2426 http://images.proteinatlas.org/12703/34647_B_9_1.jpg Skin 2 Epidermal cells not detected negative none none Male 69 3263 http://images.proteinatlas.org/12703/34647_B_6_8.jpg Female 73 3318 http://images.proteinatlas.org/12703/34647_B_5_8.jpg Female 54 3403 http://images.proteinatlas.org/12703/34647_B_4_8.jpg Small intestine Glandular cells not detected negative none none Female 84 2256 http://images.proteinatlas.org/12703/34647_A_5_2.jpg Female 51 2467 http://images.proteinatlas.org/12703/34647_A_4_2.jpg Female 56 3343 http://images.proteinatlas.org/12703/34647_A_6_2.jpg Smooth muscle Smooth muscle cells low weak >75% cytoplasmic/membranous Male 16 1767 http://images.proteinatlas.org/12703/34647_B_6_7.jpg Male 67 2404 http://images.proteinatlas.org/12703/34647_B_5_7.jpg Soft tissue 1 Chondrocytes not detected negative none none Fibroblasts medium moderate >75% cytoplasmic/membranous Peripheral nerve medium moderate >75% cytoplasmic/membranous Female 50 1176 http://images.proteinatlas.org/12703/34647_B_3_8.jpg Male 72 2178 http://images.proteinatlas.org/12703/34647_B_2_8.jpg Female 53 3482 http://images.proteinatlas.org/12703/34647_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 75 2042 http://images.proteinatlas.org/12703/34647_B_1_7.jpg Male 83 2360 http://images.proteinatlas.org/12703/34647_B_3_7.jpg Female 35 2587 http://images.proteinatlas.org/12703/34647_B_2_7.jpg Spleen Cells in red pulp not detected weak <25% cytoplasmic/membranous Cells in white pulp high strong >75% cytoplasmic/membranous Male 72 1714 http://images.proteinatlas.org/12703/34647_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/12703/34647_B_9_4.jpg Male 36 2940 http://images.proteinatlas.org/12703/34647_B_8_4.jpg Stomach 1 Glandular cells low weak 75%-25% cytoplasmic/membranous Female 56 2130 http://images.proteinatlas.org/12703/34647_A_5_1.jpg Male 72 2583 http://images.proteinatlas.org/12703/34647_A_4_1.jpg Male 39 3368 http://images.proteinatlas.org/12703/34647_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Female 75 1534 http://images.proteinatlas.org/12703/34647_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/12703/34647_A_1_1.jpg Female 56 3233 http://images.proteinatlas.org/12703/34647_A_3_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected weak <25% cytoplasmic/membranous Male 71 1818 http://images.proteinatlas.org/12703/34647_A_4_6.jpg Male 26 2254 http://images.proteinatlas.org/12703/34647_A_5_6.jpg Male 46 2435 http://images.proteinatlas.org/12703/34647_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Male 56 1672 http://images.proteinatlas.org/12703/34647_B_2_5.jpg Female 44 3005 http://images.proteinatlas.org/12703/34647_B_3_5.jpg Female 28 3536 http://images.proteinatlas.org/12703/34647_B_1_5.jpg Tonsil Germinal center cells low moderate <25% cytoplasmic/membranous Non-germinal center cells high strong 75%-25% cytoplasmic/membranous Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 37 2512 http://images.proteinatlas.org/12703/34647_A_6_8.jpg Male 17 2615 http://images.proteinatlas.org/12703/34647_A_5_8.jpg Female 19 3294 http://images.proteinatlas.org/12703/34647_A_4_8.jpg Urinary bladder Urothelial cells low moderate <25% cytoplasmic/membranous Male 46 3186 http://images.proteinatlas.org/12703/34647_A_5_5.jpg Female 79 3265 http://images.proteinatlas.org/12703/34647_A_6_5.jpg Male 55 3316 http://images.proteinatlas.org/12703/34647_A_4_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/12703/34647_B_1_2.jpg Female 44 2480 http://images.proteinatlas.org/12703/34647_B_2_2.jpg Female 32 2841 http://images.proteinatlas.org/12703/34647_B_3_2.jpg

Breast cancer Tumor cells medium not detected Female 80 1874 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_6_1.jpg http://images.proteinatlas.org/12703/34644_A_6_2.jpg Female 46 1882 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_4_3.jpg http://images.proteinatlas.org/12703/34644_A_4_4.jpg Female 61 1910 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_A_6_7.jpg http://images.proteinatlas.org/12703/34644_A_6_8.jpg Female 87 1939 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_6_5.jpg http://images.proteinatlas.org/12703/34644_A_6_6.jpg Female 50 1977 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_5_7.jpg http://images.proteinatlas.org/12703/34644_A_5_8.jpg Female 51 2083 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_4_5.jpg http://images.proteinatlas.org/12703/34644_A_4_6.jpg Female 40 2091 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_4_7.jpg http://images.proteinatlas.org/12703/34644_A_4_8.jpg Female 27 2392 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_6_3.jpg http://images.proteinatlas.org/12703/34644_A_6_4.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_5_3.jpg http://images.proteinatlas.org/12703/34644_A_5_4.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_5_1.jpg http://images.proteinatlas.org/12703/34644_A_5_2.jpg Female 41 2898 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_4_1.jpg http://images.proteinatlas.org/12703/34644_A_4_2.jpg Female 39 3257 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_5_5.jpg http://images.proteinatlas.org/12703/34644_A_5_6.jpg Carcinoid Tumor cells high not detected Male 60 1425 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_1_3.jpg http://images.proteinatlas.org/12703/34645_A_1_4.jpg Female 61 1832 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_1_1.jpg http://images.proteinatlas.org/12703/34645_A_1_2.jpg Female 54 2088 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_1_5.jpg http://images.proteinatlas.org/12703/34645_A_1_6.jpg Male 41 2618 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_1_7.jpg http://images.proteinatlas.org/12703/34645_A_1_8.jpg Cervical cancer Tumor cells low not detected Female 40 978 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_6_3.jpg http://images.proteinatlas.org/12703/34644_B_6_4.jpg Female 39 1716 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_B_4_3.jpg http://images.proteinatlas.org/12703/34644_B_4_4.jpg Female 34 1751 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_5_1.jpg http://images.proteinatlas.org/12703/34644_B_5_2.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_4_5.jpg http://images.proteinatlas.org/12703/34644_B_4_6.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_5_5.jpg http://images.proteinatlas.org/12703/34644_B_5_6.jpg Female 44 2528 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_B_6_7.jpg http://images.proteinatlas.org/12703/34644_B_6_8.jpg Female 32 2841 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_4_1.jpg http://images.proteinatlas.org/12703/34644_B_4_2.jpg Female 38 2988 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_B_6_1.jpg http://images.proteinatlas.org/12703/34644_B_6_2.jpg Female 35 3333 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_4_7.jpg http://images.proteinatlas.org/12703/34644_B_4_8.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_6_5.jpg http://images.proteinatlas.org/12703/34644_B_6_6.jpg Female 46 3400 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_5_7.jpg http://images.proteinatlas.org/12703/34644_B_5_8.jpg Female 63 3409 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_B_5_3.jpg http://images.proteinatlas.org/12703/34644_B_5_4.jpg Colorectal cancer Tumor cells medium low not detected Male 45 693 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_2_7.jpg http://images.proteinatlas.org/12703/34644_A_2_8.jpg Male 71 1898 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_2_3.jpg http://images.proteinatlas.org/12703/34644_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_1_5.jpg http://images.proteinatlas.org/12703/34644_A_1_6.jpg Male 92 2001 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_2_1.jpg http://images.proteinatlas.org/12703/34644_A_2_2.jpg Female 66 2060 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_A_3_7.jpg http://images.proteinatlas.org/12703/34644_A_3_8.jpg Male 72 2096 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_3_3.jpg http://images.proteinatlas.org/12703/34644_A_3_4.jpg Female 86 2106 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_1_1.jpg http://images.proteinatlas.org/12703/34644_A_1_2.jpg Female 75 2151 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_3_5.jpg http://images.proteinatlas.org/12703/34644_A_3_6.jpg Female 57 2619 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_A_2_5.jpg http://images.proteinatlas.org/12703/34644_A_2_6.jpg Male 72 3074 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_1_7.jpg Female 57 3264 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_A_3_1.jpg http://images.proteinatlas.org/12703/34644_A_3_2.jpg Male 63 3408 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34644_A_1_3.jpg http://images.proteinatlas.org/12703/34644_A_1_4.jpg Endometrial cancer Tumor cells not detected Female 60 1379 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_7_7.jpg http://images.proteinatlas.org/12703/34644_B_7_8.jpg Female 83 1750 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_9_7.jpg http://images.proteinatlas.org/12703/34644_B_9_8.jpg Female 53 1766 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_8_7.jpg http://images.proteinatlas.org/12703/34644_B_8_8.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_9_1.jpg http://images.proteinatlas.org/12703/34644_B_9_2.jpg Female 70 2118 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_7_1.jpg http://images.proteinatlas.org/12703/34644_B_7_2.jpg Female 79 2339 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_9_3.jpg http://images.proteinatlas.org/12703/34644_B_9_4.jpg Female 58 2455 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_8_1.jpg http://images.proteinatlas.org/12703/34644_B_8_2.jpg Female 81 2607 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_8_5.jpg http://images.proteinatlas.org/12703/34644_B_8_6.jpg Female 63 2772 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_7_3.jpg http://images.proteinatlas.org/12703/34644_B_7_4.jpg Female 85 3319 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_7_5.jpg http://images.proteinatlas.org/12703/34644_B_7_6.jpg Female 70 3367 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_8_3.jpg http://images.proteinatlas.org/12703/34644_B_8_4.jpg Glioma Tumor cells medium not detected Male 58 156 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_5_3.jpg http://images.proteinatlas.org/12703/34645_A_5_4.jpg Male 77 1537 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_5_7.jpg http://images.proteinatlas.org/12703/34645_A_5_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_4_1.jpg http://images.proteinatlas.org/12703/34645_A_4_2.jpg Male 33 1627 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_6_3.jpg http://images.proteinatlas.org/12703/34645_A_6_4.jpg Male 60 2726 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_6_1.jpg http://images.proteinatlas.org/12703/34645_A_6_2.jpg Male 47 2750 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_6_5.jpg http://images.proteinatlas.org/12703/34645_A_6_6.jpg Male 71 3091 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_6_7.jpg http://images.proteinatlas.org/12703/34645_A_6_8.jpg Male 48 3092 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_5_5.jpg http://images.proteinatlas.org/12703/34645_A_5_6.jpg Male 38 3120 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_4_3.jpg http://images.proteinatlas.org/12703/34645_A_4_4.jpg Male 77 3137 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_4_5.jpg http://images.proteinatlas.org/12703/34645_A_4_6.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_5_2.jpg Female 58 3241 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_4_7.jpg http://images.proteinatlas.org/12703/34645_A_4_8.jpg Head and neck cancer Tumor cells high medium not detected Female 59 773 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_2_7.jpg http://images.proteinatlas.org/12703/34645_A_2_8.jpg Female 55 797 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_2_5.jpg http://images.proteinatlas.org/12703/34645_A_2_6.jpg Female 50 1176 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_2_1.jpg http://images.proteinatlas.org/12703/34645_A_2_2.jpg Male 62 2580 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_2_4.jpg Liver cancer Tumor cells medium low not detected Female 65 282 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_9_5.jpg http://images.proteinatlas.org/12703/34646_B_9_6.jpg Female 65 937 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_7_6.jpg Female 58 2177 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_B_8_1.jpg http://images.proteinatlas.org/12703/34646_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_7_1.jpg http://images.proteinatlas.org/12703/34646_B_7_2.jpg Male 80 2280 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_9_1.jpg http://images.proteinatlas.org/12703/34646_B_9_2.jpg Female 52 2399 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_8_7.jpg http://images.proteinatlas.org/12703/34646_B_8_8.jpg Male 72 2556 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_9_3.jpg http://images.proteinatlas.org/12703/34646_B_9_4.jpg Male 50 2578 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_B_8_3.jpg http://images.proteinatlas.org/12703/34646_B_8_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_7_7.jpg http://images.proteinatlas.org/12703/34646_B_7_8.jpg Male 65 3196 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_B_8_5.jpg http://images.proteinatlas.org/12703/34646_B_8_6.jpg Female 61 3215 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_7_3.jpg http://images.proteinatlas.org/12703/34646_B_7_4.jpg Lung cancer Tumor cells high not detected Male 84 1394 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_3_7.jpg http://images.proteinatlas.org/12703/34645_B_3_8.jpg Male 57 1428 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_2_4.jpg Female 63 1765 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_B_1_7.jpg http://images.proteinatlas.org/12703/34645_B_1_8.jpg Male 64 1847 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_3_5.jpg http://images.proteinatlas.org/12703/34645_B_3_6.jpg Female 51 2041 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_3_1.jpg http://images.proteinatlas.org/12703/34645_B_3_2.jpg Male 66 2050 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_B_2_5.jpg http://images.proteinatlas.org/12703/34645_B_2_6.jpg Female 47 2100 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_1_5.jpg http://images.proteinatlas.org/12703/34645_B_1_6.jpg Male 71 2231 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_2_7.jpg http://images.proteinatlas.org/12703/34645_B_2_8.jpg Female 65 2403 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_3_3.jpg http://images.proteinatlas.org/12703/34645_B_3_4.jpg Male 49 3003 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_2_1.jpg http://images.proteinatlas.org/12703/34645_B_2_2.jpg Female 73 3016 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_1_3.jpg http://images.proteinatlas.org/12703/34645_B_1_4.jpg Female 70 3391 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_1_1.jpg http://images.proteinatlas.org/12703/34645_B_1_2.jpg Lymphoma Tumor cells high medium not detected Female 50 1596 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_7_7.jpg http://images.proteinatlas.org/12703/34645_A_7_8.jpg Female 36 1606 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_7_5.jpg http://images.proteinatlas.org/12703/34645_A_7_6.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_7_1.jpg http://images.proteinatlas.org/12703/34645_A_7_2.jpg Female 19 1734 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_8_7.jpg http://images.proteinatlas.org/12703/34645_A_8_8.jpg Male 18 2604 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_9_7.jpg http://images.proteinatlas.org/12703/34645_A_9_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_9_1.jpg http://images.proteinatlas.org/12703/34645_A_9_2.jpg Female 67 2751 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_9_5.jpg http://images.proteinatlas.org/12703/34645_A_9_6.jpg Male 83 2883 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_8_1.jpg http://images.proteinatlas.org/12703/34645_A_8_2.jpg Female 76 3010 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_8_5.jpg http://images.proteinatlas.org/12703/34645_A_8_6.jpg Female 77 3018 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_7_3.jpg http://images.proteinatlas.org/12703/34645_A_7_4.jpg Male 76 3078 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_8_3.jpg http://images.proteinatlas.org/12703/34645_A_8_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_9_3.jpg http://images.proteinatlas.org/12703/34645_A_9_4.jpg Melanoma Tumor cells medium not detected Male 59 1414 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_6_5.jpg http://images.proteinatlas.org/12703/34645_B_6_6.jpg Male 61 1482 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_6_7.jpg http://images.proteinatlas.org/12703/34645_B_6_8.jpg Male 41 2112 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_5_8.jpg Female 87 2136 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_4_5.jpg http://images.proteinatlas.org/12703/34645_B_4_6.jpg Male 64 2317 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_6_1.jpg http://images.proteinatlas.org/12703/34645_B_6_2.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_4_1.jpg http://images.proteinatlas.org/12703/34645_B_4_2.jpg Female 30 2598 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_B_5_5.jpg http://images.proteinatlas.org/12703/34645_B_5_6.jpg Female 73 2900 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_4_7.jpg http://images.proteinatlas.org/12703/34645_B_4_8.jpg Female 81 3210 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_4_3.jpg http://images.proteinatlas.org/12703/34645_B_4_4.jpg Female 46 3223 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_6_4.jpg Female 64 3260 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_5_1.jpg http://images.proteinatlas.org/12703/34645_B_5_2.jpg Male 64 3366 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_5_3.jpg http://images.proteinatlas.org/12703/34645_B_5_4.jpg Ovarian cancer Tumor cells not detected Female 37 857 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_2_7.jpg http://images.proteinatlas.org/12703/34644_B_2_8.jpg Female 73 1844 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_2_3.jpg http://images.proteinatlas.org/12703/34644_B_2_4.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_3_5.jpg http://images.proteinatlas.org/12703/34644_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_2_1.jpg http://images.proteinatlas.org/12703/34644_B_2_2.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_1_1.jpg http://images.proteinatlas.org/12703/34644_B_1_2.jpg Female 69 2391 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_3_7.jpg http://images.proteinatlas.org/12703/34644_B_3_8.jpg Female 62 2568 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_1_3.jpg http://images.proteinatlas.org/12703/34644_B_1_4.jpg Female 80 2747 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_3_3.jpg http://images.proteinatlas.org/12703/34644_B_3_4.jpg Female 79 2889 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_1_5.jpg http://images.proteinatlas.org/12703/34644_B_1_6.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_3_1.jpg http://images.proteinatlas.org/12703/34644_B_3_2.jpg Female 44 3146 Not detected Negative None none http://images.proteinatlas.org/12703/34644_B_1_7.jpg http://images.proteinatlas.org/12703/34644_B_1_8.jpg Pancreatic cancer Tumor cells medium low not detected Female 77 645 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_6_7.jpg http://images.proteinatlas.org/12703/34646_B_6_8.jpg Male 56 956 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_5_7.jpg http://images.proteinatlas.org/12703/34646_B_5_8.jpg Male 63 1647 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_B_4_1.jpg http://images.proteinatlas.org/12703/34646_B_4_2.jpg Male 50 1904 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_6_5.jpg http://images.proteinatlas.org/12703/34646_B_6_6.jpg Female 71 3004 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_4_3.jpg http://images.proteinatlas.org/12703/34646_B_4_4.jpg Female 56 3233 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_B_4_5.jpg http://images.proteinatlas.org/12703/34646_B_4_6.jpg Female 78 3363 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_5_5.jpg http://images.proteinatlas.org/12703/34646_B_5_6.jpg Male 77 3590 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_5_1.jpg http://images.proteinatlas.org/12703/34646_B_5_2.jpg Male 55 3593 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_B_6_2.jpg Prostate cancer Tumor cells not detected Male 89 2828 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_7_5.jpg http://images.proteinatlas.org/12703/34644_A_7_6.jpg Male 72 2830 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_9_1.jpg http://images.proteinatlas.org/12703/34644_A_9_2.jpg Male 55 3316 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_8_3.jpg http://images.proteinatlas.org/12703/34644_A_8_4.jpg Male 59 3451 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_9_5.jpg http://images.proteinatlas.org/12703/34644_A_9_6.jpg Male 59 3483 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_8_1.jpg http://images.proteinatlas.org/12703/34644_A_8_2.jpg Male 61 3486 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_8_7.jpg http://images.proteinatlas.org/12703/34644_A_8_8.jpg Male 71 3571 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_7_3.jpg http://images.proteinatlas.org/12703/34644_A_7_4.jpg Male 65 3572 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_7_7.jpg http://images.proteinatlas.org/12703/34644_A_7_8.jpg Male 63 3573 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_9_7.jpg http://images.proteinatlas.org/12703/34644_A_9_8.jpg Male 69 3580 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_8_5.jpg http://images.proteinatlas.org/12703/34644_A_8_6.jpg Male 60 3586 Not detected Negative None none http://images.proteinatlas.org/12703/34644_A_7_1.jpg http://images.proteinatlas.org/12703/34644_A_7_2.jpg Renal cancer Tumor cells low not detected Female 70 1498 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_7_3.jpg http://images.proteinatlas.org/12703/34646_A_7_4.jpg Female 60 1722 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_7_1.jpg http://images.proteinatlas.org/12703/34646_A_7_2.jpg Male 56 1752 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_8_1.jpg http://images.proteinatlas.org/12703/34646_A_8_2.jpg Male 77 1831 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_A_8_5.jpg http://images.proteinatlas.org/12703/34646_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_9_3.jpg http://images.proteinatlas.org/12703/34646_A_9_4.jpg Male 63 1969 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_9_1.jpg http://images.proteinatlas.org/12703/34646_A_9_2.jpg Female 72 2067 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_7_5.jpg http://images.proteinatlas.org/12703/34646_A_7_6.jpg Male 59 2176 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_7_7.jpg http://images.proteinatlas.org/12703/34646_A_7_8.jpg Male 68 2452 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_A_8_3.jpg http://images.proteinatlas.org/12703/34646_A_8_4.jpg Male 61 2540 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_A_9_7.jpg Female 52 2564 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_A_8_7.jpg Female 57 3061 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_9_5.jpg http://images.proteinatlas.org/12703/34646_A_9_6.jpg Skin cancer Tumor cells not detected Female 64 1335 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_8_5.jpg http://images.proteinatlas.org/12703/34645_B_8_6.jpg Male 24 1693 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_7_1.jpg http://images.proteinatlas.org/12703/34645_B_7_2.jpg Female 73 1738 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_8_3.jpg http://images.proteinatlas.org/12703/34645_B_8_4.jpg Female 84 1942 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_8_7.jpg http://images.proteinatlas.org/12703/34645_B_8_8.jpg Male 75 2111 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_7_3.jpg http://images.proteinatlas.org/12703/34645_B_7_4.jpg Male 87 2548 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_9_6.jpg Male 84 3008 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_9_3.jpg http://images.proteinatlas.org/12703/34645_B_9_4.jpg Male 86 3014 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_7_5.jpg http://images.proteinatlas.org/12703/34645_B_7_6.jpg Male 87 3152 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_9_7.jpg http://images.proteinatlas.org/12703/34645_B_9_8.jpg Female 88 3163 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_7_7.jpg http://images.proteinatlas.org/12703/34645_B_7_8.jpg Female 44 3261 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_8_1.jpg http://images.proteinatlas.org/12703/34645_B_8_2.jpg Female 70 3268 Not detected Negative None none http://images.proteinatlas.org/12703/34645_B_9_1.jpg http://images.proteinatlas.org/12703/34645_B_9_2.jpg Stomach cancer Tumor cells low not detected Male 88 1158 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_2_1.jpg http://images.proteinatlas.org/12703/34646_B_2_2.jpg Male 82 1787 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_1_2.jpg Male 76 2066 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/12703/34646_B_1_3.jpg http://images.proteinatlas.org/12703/34646_B_1_4.jpg Male 62 2105 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_1_7.jpg http://images.proteinatlas.org/12703/34646_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_B_2_7.jpg http://images.proteinatlas.org/12703/34646_B_2_8.jpg Male 48 2195 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_3_1.jpg http://images.proteinatlas.org/12703/34646_B_3_2.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_2_5.jpg http://images.proteinatlas.org/12703/34646_B_2_6.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_3_5.jpg http://images.proteinatlas.org/12703/34646_B_3_6.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_2_3.jpg http://images.proteinatlas.org/12703/34646_B_2_4.jpg Female 73 2557 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_1_5.jpg http://images.proteinatlas.org/12703/34646_B_1_6.jpg Female 89 3270 Not detected Negative None none http://images.proteinatlas.org/12703/34646_B_3_3.jpg http://images.proteinatlas.org/12703/34646_B_3_4.jpg Testis cancer Tumor cells not detected Male 52 938 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_3_1.jpg http://images.proteinatlas.org/12703/34646_A_3_2.jpg Male 38 1233 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_3_3.jpg http://images.proteinatlas.org/12703/34646_A_3_4.jpg Male 21 1340 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_1_5.jpg http://images.proteinatlas.org/12703/34646_A_1_6.jpg Male 41 1700 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_3_5.jpg http://images.proteinatlas.org/12703/34646_A_3_6.jpg Male 36 1740 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_1_7.jpg http://images.proteinatlas.org/12703/34646_A_1_8.jpg Male 43 1777 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_2_5.jpg http://images.proteinatlas.org/12703/34646_A_2_6.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_2_3.jpg http://images.proteinatlas.org/12703/34646_A_2_4.jpg Male 59 1900 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_2_1.jpg http://images.proteinatlas.org/12703/34646_A_2_2.jpg Male 26 2071 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_1_3.jpg http://images.proteinatlas.org/12703/34646_A_1_4.jpg Male 19 2116 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_1_1.jpg http://images.proteinatlas.org/12703/34646_A_1_2.jpg Male 65 2558 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_2_7.jpg http://images.proteinatlas.org/12703/34646_A_2_8.jpg Male 22 2721 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_3_7.jpg http://images.proteinatlas.org/12703/34646_A_3_8.jpg Thyroid cancer Tumor cells low not detected Male 77 2623 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34645_A_3_5.jpg http://images.proteinatlas.org/12703/34645_A_3_6.jpg Male 75 3107 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_3_3.jpg http://images.proteinatlas.org/12703/34645_A_3_4.jpg Female 30 3131 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_3_7.jpg http://images.proteinatlas.org/12703/34645_A_3_8.jpg Male 33 3267 Not detected Negative None none http://images.proteinatlas.org/12703/34645_A_3_1.jpg http://images.proteinatlas.org/12703/34645_A_3_2.jpg Urothelial cancer Tumor cells medium not detected Male 78 1774 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_4_3.jpg http://images.proteinatlas.org/12703/34646_A_4_4.jpg Male 66 1824 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_5_1.jpg http://images.proteinatlas.org/12703/34646_A_5_2.jpg Female 85 1871 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_6_1.jpg http://images.proteinatlas.org/12703/34646_A_6_2.jpg Female 80 2031 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_5_3.jpg http://images.proteinatlas.org/12703/34646_A_5_4.jpg Male 51 2053 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_6_7.jpg http://images.proteinatlas.org/12703/34646_A_6_8.jpg Male 35 2311 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_4_5.jpg http://images.proteinatlas.org/12703/34646_A_4_6.jpg Male 78 2469 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_4_7.jpg http://images.proteinatlas.org/12703/34646_A_4_8.jpg Male 77 2802 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_5_5.jpg http://images.proteinatlas.org/12703/34646_A_5_6.jpg Male 46 3184 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/12703/34646_A_6_5.jpg http://images.proteinatlas.org/12703/34646_A_6_6.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/12703/34646_A_4_1.jpg http://images.proteinatlas.org/12703/34646_A_4_2.jpg IGHG2 Intracellular, Membrane, Secreted (different isoforms)

approved Liver http://images.proteinatlas.org/1245/3618_A_9_4_rna_selected.jpg Colon http://images.proteinatlas.org/1245/3618_A_9_3_rna_selected.jpg Kidney http://images.proteinatlas.org/1245/3618_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/1245/3618_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/1245/3618_A_8_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/1245/3618_B_8_5_rna_selected.jpg Adipose tissue medium Adipocytes medium Adrenal gland medium Glandular cells medium Appendix medium Glandular cells not detected Lymphoid tissue medium Bone marrow high Hematopoietic cells high Breast medium Adipocytes medium Glandular cells not detected Myoepithelial cells not detected Bronchus low Respiratory epithelial cells low Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix low Glandular cells low Colon medium Endothelial cells medium Glandular cells not detected Duodenum low Glandular cells low Endometrium 1 medium Cells in endometrial stroma medium Glandular cells not detected Endometrium 2 medium Cells in endometrial stroma medium Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube low Glandular cells low Gallbladder low Glandular cells low Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney medium Cells in glomeruli medium Cells in tubules medium Liver medium Cholangiocytes not detected Hepatocytes medium Lung medium Alveolar cells medium Macrophages medium Lymph node low Germinal center cells low Non-germinal center cells low Oral mucosa low Squamous epithelial cells low Ovary medium Follicle cells low Ovarian stroma cells medium Pancreas medium Exocrine glandular cells medium Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta high Decidual cells not detected Trophoblastic cells high Prostate medium Glandular cells medium Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle low Glandular cells low Skeletal muscle low Myocytes low Skin 1 medium Fibroblasts not detected Keratinocytes not detected Langerhans medium Melanocytes low Skin 2 low Epidermal cells low Small intestine medium Glandular cells medium Smooth muscle not detected Smooth muscle cells not detected Soft tissue 2 not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 low Glandular cells low Stomach 2 not detected Glandular cells not detected Testis medium Cells in seminiferous ducts not detected Leydig cells medium Thyroid gland low Glandular cells low Tonsil high Germinal center cells low Non-germinal center cells high Squamous epithelial cells low Urinary bladder low Urothelial cells low Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RH-30 RPMI-8226 Detected in some RPMI-8226 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single B-cells Plasma cells Detected in some Plasma cells - Humoral immune response LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD

approved Medium consistency between antibody staining and RNA expression data Not done http://images.proteinatlas.org/1245/ihc_selected.jpg Adipose tissue Adipocytes medium moderate >75% cytoplasmic/membranous Female 24 1856 http://images.proteinatlas.org/1245/3618_B_1_8.jpg Female 37 2174 http://images.proteinatlas.org/1245/3618_B_2_7.jpg Female 67 2208 http://images.proteinatlas.org/1245/3618_B_1_7.jpg Adrenal gland Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 71 1966 http://images.proteinatlas.org/1245/3618_B_6_5.jpg Male 35 2212 http://images.proteinatlas.org/1245/3618_B_4_5.jpg Female 44 2374 http://images.proteinatlas.org/1245/3618_B_5_5.jpg Appendix Glandular cells not detected weak <25% cytoplasmic/membranous Lymphoid tissue medium moderate 75%-25% cytoplasmic/membranous Male 38 2068 http://images.proteinatlas.org/1245/3618_A_2_2.jpg Female 66 2154 http://images.proteinatlas.org/1245/3618_A_3_2.jpg Female 9 2191 http://images.proteinatlas.org/1245/3618_A_1_2.jpg Bone marrow Hematopoietic cells high strong 75%-25% cytoplasmic/membranous Male 69 2673 http://images.proteinatlas.org/1245/3618_B_5_4.jpg Female 53 2674 http://images.proteinatlas.org/1245/3618_B_6_4.jpg Breast Adipocytes medium moderate >75% cytoplasmic/membranous Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 39 1801 http://images.proteinatlas.org/1245/3618_B_2_4.jpg Female 75 2042 http://images.proteinatlas.org/1245/3618_B_3_4.jpg Female 23 2259 http://images.proteinatlas.org/1245/3618_B_1_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 2100 http://images.proteinatlas.org/1245/3618_B_4_2.jpg Male 64 2317 http://images.proteinatlas.org/1245/3618_B_5_2.jpg Female 56 2336 http://images.proteinatlas.org/1245/3618_B_6_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/1245/3618_B_9_7.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/1245/3618_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_9_8.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected negative none none Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/1245/3618_B_7_5.jpg Male 77 1537 http://images.proteinatlas.org/1245/3618_B_9_5.jpg Female 45 1539 http://images.proteinatlas.org/1245/3618_B_8_5.jpg Cervix Glandular cells low weak 75%-25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/1245/3618_B_7_3.jpg Female 40 2200 http://images.proteinatlas.org/1245/3618_B_8_3.jpg Female 39 2380 http://images.proteinatlas.org/1245/3618_B_9_3.jpg Colon Endothelial cells medium moderate >75% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Female 61 1832 http://images.proteinatlas.org/1245/3618_A_9_3.jpg Duodenum Glandular cells low weak 75%-25% cytoplasmic/membranous Male 50 1904 http://images.proteinatlas.org/1245/3618_A_7_2.jpg Male 66 2329 http://images.proteinatlas.org/1245/3618_A_9_2.jpg Female 64 2338 http://images.proteinatlas.org/1245/3618_A_8_2.jpg Endometrium 1 Cells in endometrial stroma medium moderate >75% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/1245/3618_B_4_3.jpg Female 42 2242 http://images.proteinatlas.org/1245/3618_B_6_3.jpg Endometrium 2 Cells in endometrial stroma medium moderate 75%-25% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Female 72 1978 http://images.proteinatlas.org/1245/3618_B_2_3.jpg Female 61 2014 http://images.proteinatlas.org/1245/3618_B_1_3.jpg Epididymis Glandular cells not detected negative none none Male 36 1740 http://images.proteinatlas.org/1245/3618_A_3_6.jpg Male 26 1995 http://images.proteinatlas.org/1245/3618_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 62 2105 http://images.proteinatlas.org/1245/3618_B_5_1.jpg Fallopian tube Glandular cells low weak 75%-25% cytoplasmic/membranous Female 29 1830 http://images.proteinatlas.org/1245/3618_A_9_7.jpg Female 51 2389 http://images.proteinatlas.org/1245/3618_A_8_7.jpg Female 33 2394 http://images.proteinatlas.org/1245/3618_A_7_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Female 63 2201 http://images.proteinatlas.org/1245/3618_A_5_4.jpg Female 24 2381 http://images.proteinatlas.org/1245/3618_A_4_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 49 2278 http://images.proteinatlas.org/1245/3618_B_5_6.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_6_6.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_4_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/1245/3618_B_8_6.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_9_6.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_7_6.jpg Kidney Cells in glomeruli medium moderate 75%-25% cytoplasmic/membranous Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Female 56 1933 http://images.proteinatlas.org/1245/3618_A_7_5.jpg Male 28 1943 http://images.proteinatlas.org/1245/3618_A_8_5.jpg Male 7 2165 http://images.proteinatlas.org/1245/3618_A_9_5.jpg Liver Cholangiocytes not detected weak <25% cytoplasmic/membranous Hepatocytes medium moderate 75%-25% cytoplasmic/membranous Male 67 1720 http://images.proteinatlas.org/1245/3618_A_7_4.jpg Female 32 1846 http://images.proteinatlas.org/1245/3618_A_8_4.jpg Female 29 1899 http://images.proteinatlas.org/1245/3618_A_9_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Female 49 2268 http://images.proteinatlas.org/1245/3618_A_2_4.jpg Male 69 2373 http://images.proteinatlas.org/1245/3618_A_3_4.jpg Male 59 2417 http://images.proteinatlas.org/1245/3618_A_1_4.jpg Lymph node Germinal center cells low moderate <25% cytoplasmic/membranous Non-germinal center cells low weak 75%-25% cytoplasmic/membranous Male 46 2371 http://images.proteinatlas.org/1245/3618_A_7_8.jpg Male 3 2405 http://images.proteinatlas.org/1245/3618_A_8_8.jpg Oral mucosa Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Male 62 1505 http://images.proteinatlas.org/1245/3618_A_9_1.jpg Female 84 2406 http://images.proteinatlas.org/1245/3618_A_8_1.jpg Male 20 2519 http://images.proteinatlas.org/1245/3618_A_7_1.jpg Ovary Follicle cells low weak 75%-25% cytoplasmic/membranous Ovarian stroma cells medium moderate 75%-25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/1245/3618_A_5_7.jpg Female 33 2159 http://images.proteinatlas.org/1245/3618_A_6_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/1245/3618_A_1_3.jpg Female 43 2220 http://images.proteinatlas.org/1245/3618_A_2_3.jpg Male 66 2329 http://images.proteinatlas.org/1245/3618_A_3_3.jpg Parathyroid gland Glandular cells not detected weak <25% cytoplasmic/membranous Female 37 1889 http://images.proteinatlas.org/1245/3618_A_1_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells high strong >75% cytoplasmic/membranous Female 35 1814 http://images.proteinatlas.org/1245/3618_A_1_7.jpg Female 19 2169 http://images.proteinatlas.org/1245/3618_A_2_7.jpg Female 30 2515 http://images.proteinatlas.org/1245/3618_A_3_7.jpg Prostate Glandular cells medium moderate 75%-25% cytoplasmic/membranous Male 64 1938 http://images.proteinatlas.org/1245/3618_A_2_5.jpg Male 51 2053 http://images.proteinatlas.org/1245/3618_A_1_5.jpg Rectum Glandular cells not detected weak <25% cytoplasmic/membranous Female 46 1876 http://images.proteinatlas.org/1245/3618_A_4_3.jpg Male 92 2001 http://images.proteinatlas.org/1245/3618_A_5_3.jpg Female 66 2060 http://images.proteinatlas.org/1245/3618_A_6_3.jpg Salivary gland Glandular cells not detected negative none none Female 32 1364 http://images.proteinatlas.org/1245/3618_B_3_1.jpg Male 8 1636 http://images.proteinatlas.org/1245/3618_B_1_1.jpg Female 24 2323 http://images.proteinatlas.org/1245/3618_B_2_1.jpg Seminal vesicle Glandular cells low weak 75%-25% cytoplasmic/membranous Male 63 2017 http://images.proteinatlas.org/1245/3618_A_7_6.jpg Male 82 2023 http://images.proteinatlas.org/1245/3618_A_9_6.jpg Male 26 2254 http://images.proteinatlas.org/1245/3618_A_8_6.jpg Skeletal muscle Myocytes low moderate <25% cytoplasmic/membranous Male 62 1505 http://images.proteinatlas.org/1245/3618_B_3_6.jpg Female 37 1889 http://images.proteinatlas.org/1245/3618_B_1_6.jpg Female 58 2148 http://images.proteinatlas.org/1245/3618_B_2_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected weak <25% cytoplasmic/membranous Langerhans medium moderate >75% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 63 2418 http://images.proteinatlas.org/1245/3618_B_8_1.jpg Skin 2 Epidermal cells low weak 75%-25% cytoplasmic/membranous Female 68 1970 http://images.proteinatlas.org/1245/3618_B_5_8.jpg Female 15 2027 http://images.proteinatlas.org/1245/3618_B_4_8.jpg Female 78 2045 http://images.proteinatlas.org/1245/3618_B_6_8.jpg Small intestine Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 61 1839 http://images.proteinatlas.org/1245/3618_A_5_2.jpg Male 41 2226 http://images.proteinatlas.org/1245/3618_A_6_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 70 2118 http://images.proteinatlas.org/1245/3618_B_6_7.jpg Female 39 2225 http://images.proteinatlas.org/1245/3618_B_4_7.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 37 2174 http://images.proteinatlas.org/1245/3618_B_2_7.jpg Female 67 2208 http://images.proteinatlas.org/1245/3618_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Female 50 1632 http://images.proteinatlas.org/1245/3618_B_9_4.jpg Male 72 1714 http://images.proteinatlas.org/1245/3618_B_8_4.jpg Female 10 1905 http://images.proteinatlas.org/1245/3618_B_7_4.jpg Stomach 1 Glandular cells low moderate <25% cytoplasmic/membranous Male 42 1469 http://images.proteinatlas.org/1245/3618_A_5_1.jpg Male 76 2066 http://images.proteinatlas.org/1245/3618_A_6_1.jpg Female 56 2130 http://images.proteinatlas.org/1245/3618_A_4_1.jpg Stomach 2 Glandular cells not detected weak <25% cytoplasmic/membranous Male 76 2066 http://images.proteinatlas.org/1245/3618_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/1245/3618_A_1_1.jpg Female 73 2557 http://images.proteinatlas.org/1245/3618_A_3_1.jpg Testis Cells in seminiferous ducts not detected weak <25% cytoplasmic/membranous Leydig cells medium moderate >75% cytoplasmic/membranous Male 68 1880 http://images.proteinatlas.org/1245/3618_A_5_6.jpg Male 26 2071 http://images.proteinatlas.org/1245/3618_A_4_6.jpg Male 46 2435 http://images.proteinatlas.org/1245/3618_A_6_6.jpg Thyroid gland Glandular cells low moderate <25% cytoplasmic/membranous Female 75 1501 http://images.proteinatlas.org/1245/3618_B_3_5.jpg Male 61 2072 http://images.proteinatlas.org/1245/3618_B_2_5.jpg Female 22 2146 http://images.proteinatlas.org/1245/3618_B_1_5.jpg Tonsil Germinal center cells low moderate <25% cytoplasmic/membranous Non-germinal center cells high strong 75%-25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 40 2250 http://images.proteinatlas.org/1245/3618_A_6_8.jpg Male 31 2511 http://images.proteinatlas.org/1245/3618_A_4_8.jpg Urinary bladder Urothelial cells low weak 75%-25% cytoplasmic/membranous Female 55 2047 http://images.proteinatlas.org/1245/3618_A_6_5.jpg Male 51 2053 http://images.proteinatlas.org/1245/3618_A_4_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/1245/3618_B_1_2.jpg

Breast cancer Tumor cells medium low not detected Female 72 103 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_7.jpg http://images.proteinatlas.org/1245/3615_A_5_8.jpg Female 91 108 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_4_1.jpg http://images.proteinatlas.org/1245/3615_A_4_2.jpg Female 68 159 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_4_3.jpg http://images.proteinatlas.org/1245/3615_A_4_4.jpg Female 68 261 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_1.jpg http://images.proteinatlas.org/1245/3615_A_5_2.jpg Female 45 278 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_5.jpg http://images.proteinatlas.org/1245/3615_A_6_6.jpg Female 50 315 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_3.jpg Female 58 609 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_5.jpg http://images.proteinatlas.org/1245/3615_A_5_6.jpg Female 85 614 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_4_5.jpg http://images.proteinatlas.org/1245/3615_A_4_6.jpg Female 69 659 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_7.jpg http://images.proteinatlas.org/1245/3615_A_6_8.jpg Female 53 858 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_3.jpg http://images.proteinatlas.org/1245/3615_A_6_4.jpg Female 57 1044 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_1.jpg http://images.proteinatlas.org/1245/3615_A_6_2.jpg Female 56 1155 Not detected Negative None none http://images.proteinatlas.org/1245/3615_A_4_7.jpg Carcinoid Tumor cells high medium low Female 76 227 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_3.jpg http://images.proteinatlas.org/1245/3616_A_1_4.jpg Male 63 604 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_5.jpg http://images.proteinatlas.org/1245/3616_A_1_6.jpg Male 60 997 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_1.jpg http://images.proteinatlas.org/1245/3616_A_1_2.jpg Male 55 1092 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_7.jpg http://images.proteinatlas.org/1245/3616_A_1_8.jpg Cervical cancer Tumor cells medium low not detected Female 41 361 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_5.jpg http://images.proteinatlas.org/1245/3615_B_6_6.jpg Female 41 507 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_1.jpg http://images.proteinatlas.org/1245/3615_B_4_2.jpg Female 57 642 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_5.jpg http://images.proteinatlas.org/1245/3615_B_4_6.jpg Female 57 687 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_7.jpg http://images.proteinatlas.org/1245/3615_B_6_8.jpg Female 34 828 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_3.jpg http://images.proteinatlas.org/1245/3615_B_4_4.jpg Female 54 926 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_1.jpg http://images.proteinatlas.org/1245/3615_B_6_2.jpg Female 54 947 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_3.jpg http://images.proteinatlas.org/1245/3615_B_6_4.jpg Female 38 1071 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_7.jpg http://images.proteinatlas.org/1245/3615_B_5_8.jpg Female 31 1131 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_1.jpg http://images.proteinatlas.org/1245/3615_B_5_2.jpg Female 49 1187 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_7.jpg http://images.proteinatlas.org/1245/3615_B_4_8.jpg Female 45 1192 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_6.jpg Female 41 1267 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_3.jpg http://images.proteinatlas.org/1245/3615_B_5_4.jpg Colorectal cancer Tumor cells high medium low not detected Female 81 55 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_1.jpg http://images.proteinatlas.org/1245/3615_A_2_2.jpg Female 70 157 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_3.jpg http://images.proteinatlas.org/1245/3615_A_1_4.jpg Male 76 192 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_3.jpg http://images.proteinatlas.org/1245/3615_A_2_4.jpg Male 65 257 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_7.jpg http://images.proteinatlas.org/1245/3615_A_2_8.jpg Female 82 324 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_7.jpg http://images.proteinatlas.org/1245/3615_A_3_8.jpg Female 67 415 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_5.jpg http://images.proteinatlas.org/1245/3615_A_1_6.jpg Female 65 416 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_7.jpg http://images.proteinatlas.org/1245/3615_A_1_8.jpg Female 86 418 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_1.jpg http://images.proteinatlas.org/1245/3615_A_3_2.jpg Male 54 966 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_3.jpg http://images.proteinatlas.org/1245/3615_A_3_4.jpg Female 98 1184 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_1.jpg http://images.proteinatlas.org/1245/3615_A_1_2.jpg Female 57 1314 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_5.jpg http://images.proteinatlas.org/1245/3615_A_3_6.jpg Male 55 2633 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_5.jpg http://images.proteinatlas.org/1245/3615_A_2_6.jpg Endometrial cancer Tumor cells high medium low not detected Female 79 39 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/1245/3615_B_7_2.jpg Female 76 119 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_7_3.jpg http://images.proteinatlas.org/1245/3615_B_7_4.jpg Female 75 167 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_1.jpg http://images.proteinatlas.org/1245/3615_B_9_2.jpg Female 51 300 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_7_5.jpg http://images.proteinatlas.org/1245/3615_B_7_6.jpg Female 56 309 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_7_7.jpg http://images.proteinatlas.org/1245/3615_B_7_8.jpg Female 63 312 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_5.jpg http://images.proteinatlas.org/1245/3615_B_9_6.jpg Female 55 566 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_3.jpg http://images.proteinatlas.org/1245/3615_B_9_4.jpg Female 59 575 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_7.jpg http://images.proteinatlas.org/1245/3615_B_9_8.jpg Female 75 658 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_1.jpg Female 63 718 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_3.jpg http://images.proteinatlas.org/1245/3615_B_8_4.jpg Female 66 1164 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_5.jpg http://images.proteinatlas.org/1245/3615_B_8_6.jpg Female 75 1165 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_7.jpg http://images.proteinatlas.org/1245/3615_B_8_8.jpg Glioma Tumor cells high medium low not detected Male 68 3 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_6_1.jpg http://images.proteinatlas.org/1245/3616_A_6_2.jpg Female 36 34 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_5.jpg http://images.proteinatlas.org/1245/3616_A_4_6.jpg Male 36 38 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_7.jpg http://images.proteinatlas.org/1245/3616_A_4_8.jpg Male 72 45 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_3.jpg http://images.proteinatlas.org/1245/3616_A_5_4.jpg Male 77 46 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_6_3.jpg http://images.proteinatlas.org/1245/3616_A_6_4.jpg Female 60 105 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_7.jpg http://images.proteinatlas.org/1245/3616_A_5_8.jpg Female 15 158 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_6_7.jpg http://images.proteinatlas.org/1245/3616_A_6_8.jpg Female 46 176 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_6_5.jpg http://images.proteinatlas.org/1245/3616_A_6_6.jpg Male 48 183 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_5.jpg http://images.proteinatlas.org/1245/3616_A_5_6.jpg Male 69 191 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_1.jpg http://images.proteinatlas.org/1245/3616_A_5_2.jpg Male 66 206 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_3.jpg http://images.proteinatlas.org/1245/3616_A_4_4.jpg Female 37 221 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_1.jpg http://images.proteinatlas.org/1245/3616_A_4_2.jpg Head and neck cancer Tumor cells medium low not detected Female 74 807 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_1.jpg http://images.proteinatlas.org/1245/3616_A_2_2.jpg Female 82 903 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_3.jpg http://images.proteinatlas.org/1245/3616_A_2_4.jpg Male 70 1060 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_7.jpg http://images.proteinatlas.org/1245/3616_A_2_8.jpg Male 64 1130 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_5.jpg Liver cancer Tumor cells medium low not detected Female 66 82 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_1.jpg http://images.proteinatlas.org/1245/3617_B_7_2.jpg Female 55 490 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_3.jpg http://images.proteinatlas.org/1245/3617_B_8_4.jpg Female 79 516 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_5.jpg http://images.proteinatlas.org/1245/3617_B_8_6.jpg Female 52 812 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_7.jpg http://images.proteinatlas.org/1245/3617_B_8_8.jpg Male 49 929 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_3.jpg http://images.proteinatlas.org/1245/3617_B_7_4.jpg Female 65 937 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_1.jpg http://images.proteinatlas.org/1245/3617_B_9_2.jpg Female 79 1022 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_5.jpg http://images.proteinatlas.org/1245/3617_B_9_6.jpg Male 57 1175 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_7.jpg http://images.proteinatlas.org/1245/3617_B_9_8.jpg Male 69 1251 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_7.jpg http://images.proteinatlas.org/1245/3617_B_7_8.jpg Male 24 1287 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_1.jpg http://images.proteinatlas.org/1245/3617_B_8_2.jpg Male 47 2652 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_3.jpg http://images.proteinatlas.org/1245/3617_B_9_4.jpg Female 85 2662 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_5.jpg Lung cancer Tumor cells medium low not detected Male 64 376 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_7.jpg http://images.proteinatlas.org/1245/3616_B_2_8.jpg Male 75 385 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_1_5.jpg http://images.proteinatlas.org/1245/3616_B_1_6.jpg Male 48 426 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_1.jpg http://images.proteinatlas.org/1245/3616_B_2_2.jpg Male 60 461 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_3.jpg http://images.proteinatlas.org/1245/3616_B_2_4.jpg Female 75 496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_7.jpg http://images.proteinatlas.org/1245/3616_B_3_8.jpg Female 50 537 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_5.jpg http://images.proteinatlas.org/1245/3616_B_2_6.jpg Male 60 763 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_1_7.jpg http://images.proteinatlas.org/1245/3616_B_1_8.jpg Male 68 1048 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_1_4.jpg Male 71 1199 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_1.jpg http://images.proteinatlas.org/1245/3616_B_3_2.jpg Female 44 1249 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_3.jpg http://images.proteinatlas.org/1245/3616_B_3_4.jpg Male 68 1303 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_5.jpg http://images.proteinatlas.org/1245/3616_B_3_6.jpg Lymphoma Tumor cells medium low not detected Male 57 10 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_9_1.jpg http://images.proteinatlas.org/1245/3616_A_9_2.jpg Male 50 81 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_9_3.jpg http://images.proteinatlas.org/1245/3616_A_9_4.jpg Female 70 92 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_7_5.jpg http://images.proteinatlas.org/1245/3616_A_7_6.jpg Male 49 136 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_8_7.jpg http://images.proteinatlas.org/1245/3616_A_8_8.jpg Male 46 150 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_7_7.jpg http://images.proteinatlas.org/1245/3616_A_7_8.jpg Male 65 241 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_9_7.jpg http://images.proteinatlas.org/1245/3616_A_9_8.jpg Female 51 243 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_8_1.jpg http://images.proteinatlas.org/1245/3616_A_8_2.jpg Male 82 296 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_9_5.jpg http://images.proteinatlas.org/1245/3616_A_9_6.jpg Male 74 425 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_8_5.jpg http://images.proteinatlas.org/1245/3616_A_8_6.jpg Male 8 603 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_7_1.jpg Female 59 637 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_8_3.jpg http://images.proteinatlas.org/1245/3616_A_8_4.jpg Female 56 1090 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_7_3.jpg http://images.proteinatlas.org/1245/3616_A_7_4.jpg Melanoma Tumor cells high medium low not detected Female 85 165 Not detected Negative None none http://images.proteinatlas.org/1245/3616_B_4_7.jpg Male 88 212 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_6_5.jpg http://images.proteinatlas.org/1245/3616_B_6_6.jpg Male 75 363 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_4_1.jpg http://images.proteinatlas.org/1245/3616_B_4_2.jpg Female 82 379 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_4_5.jpg http://images.proteinatlas.org/1245/3616_B_4_6.jpg Female 64 656 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_5.jpg http://images.proteinatlas.org/1245/3616_B_5_6.jpg Male 56 744 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_4_3.jpg http://images.proteinatlas.org/1245/3616_B_4_4.jpg Male 23 761 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_6_1.jpg http://images.proteinatlas.org/1245/3616_B_6_2.jpg Male 57 791 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_1.jpg http://images.proteinatlas.org/1245/3616_B_5_2.jpg Female 73 1017 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_3.jpg http://images.proteinatlas.org/1245/3616_B_5_4.jpg Female 77 1189 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_7.jpg http://images.proteinatlas.org/1245/3616_B_5_8.jpg Female 49 1277 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_6_3.jpg http://images.proteinatlas.org/1245/3616_B_6_4.jpg Male 36 1301 Not detected Negative None none http://images.proteinatlas.org/1245/3616_B_6_7.jpg Ovarian cancer Tumor cells high medium low not detected Female 52 208 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_4.jpg Female 63 393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_1.jpg http://images.proteinatlas.org/1245/3615_B_3_2.jpg Female 71 592 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_7.jpg http://images.proteinatlas.org/1245/3615_B_2_8.jpg Female 85 785 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_1.jpg http://images.proteinatlas.org/1245/3615_B_2_2.jpg Female 57 825 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_1.jpg http://images.proteinatlas.org/1245/3615_B_1_2.jpg Female 84 1010 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_3.jpg http://images.proteinatlas.org/1245/3615_B_3_4.jpg Female 64 1016 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_5.jpg http://images.proteinatlas.org/1245/3615_B_3_6.jpg Female 41 1019 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_3.jpg http://images.proteinatlas.org/1245/3615_B_2_4.jpg Female 75 1106 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_7.jpg http://images.proteinatlas.org/1245/3615_B_1_8.jpg Female 77 1115 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_7.jpg http://images.proteinatlas.org/1245/3615_B_3_8.jpg Female 45 1116 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_5.jpg http://images.proteinatlas.org/1245/3615_B_1_6.jpg Female 25 1265 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_5.jpg http://images.proteinatlas.org/1245/3615_B_2_6.jpg Pancreatic cancer Tumor cells medium low not detected Female 52 170 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_3.jpg http://images.proteinatlas.org/1245/3617_B_5_4.jpg Female 66 317 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_3.jpg http://images.proteinatlas.org/1245/3617_B_4_4.jpg Male 70 582 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_5.jpg http://images.proteinatlas.org/1245/3617_B_6_6.jpg Female 64 646 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_1.jpg http://images.proteinatlas.org/1245/3617_B_5_2.jpg Female 70 823 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_7.jpg http://images.proteinatlas.org/1245/3617_B_5_8.jpg Female 70 834 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_1.jpg http://images.proteinatlas.org/1245/3617_B_4_2.jpg Male 77 893 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_8.jpg Male 59 969 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_1.jpg http://images.proteinatlas.org/1245/3617_B_6_2.jpg Female 57 977 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_5.jpg Male 62 1212 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_5.jpg http://images.proteinatlas.org/1245/3617_B_5_6.jpg Male 77 1248 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_3.jpg http://images.proteinatlas.org/1245/3617_B_6_4.jpg Male 79 2650 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_7.jpg http://images.proteinatlas.org/1245/3617_B_6_8.jpg Prostate cancer Tumor cells high medium low not detected Male 65 78 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_5.jpg http://images.proteinatlas.org/1245/3615_A_7_6.jpg Male 71 79 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_7.jpg http://images.proteinatlas.org/1245/3615_A_7_8.jpg Male 70 137 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_3.jpg http://images.proteinatlas.org/1245/3615_A_7_4.jpg Male 59 235 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_1.jpg http://images.proteinatlas.org/1245/3615_A_7_2.jpg Male 72 244 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_7.jpg http://images.proteinatlas.org/1245/3615_A_8_8.jpg Male 64 250 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_6.jpg Male 60 277 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_3.jpg http://images.proteinatlas.org/1245/3615_A_8_4.jpg Male 72 619 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_5.jpg http://images.proteinatlas.org/1245/3615_A_9_6.jpg Male 73 633 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_3.jpg http://images.proteinatlas.org/1245/3615_A_9_4.jpg Male 67 689 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_1.jpg http://images.proteinatlas.org/1245/3615_A_9_2.jpg Male 65 1089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_7.jpg http://images.proteinatlas.org/1245/3615_A_9_8.jpg Male 56 1234 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_1.jpg http://images.proteinatlas.org/1245/3615_A_8_2.jpg Renal cancer Tumor cells high medium low not detected Male 57 310 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_7.jpg http://images.proteinatlas.org/1245/3617_A_8_8.jpg Male 61 443 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_1.jpg http://images.proteinatlas.org/1245/3617_A_9_2.jpg Female 76 567 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_7.jpg http://images.proteinatlas.org/1245/3617_A_7_8.jpg Female 73 679 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_3.jpg http://images.proteinatlas.org/1245/3617_A_7_4.jpg Male 78 726 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_5.jpg http://images.proteinatlas.org/1245/3617_A_7_6.jpg Female 62 732 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_1.jpg http://images.proteinatlas.org/1245/3617_A_7_2.jpg Female 74 734 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_5.jpg http://images.proteinatlas.org/1245/3617_A_8_6.jpg Male 59 885 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_5.jpg http://images.proteinatlas.org/1245/3617_A_9_6.jpg Male 61 913 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_7.jpg http://images.proteinatlas.org/1245/3617_A_9_8.jpg Male 63 1134 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_3.jpg http://images.proteinatlas.org/1245/3617_A_9_4.jpg Female 52 1263 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_1.jpg http://images.proteinatlas.org/1245/3617_A_8_2.jpg Male 82 2635 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_3.jpg http://images.proteinatlas.org/1245/3617_A_8_4.jpg Skin cancer Tumor cells medium low not detected Male 63 35 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_7.jpg http://images.proteinatlas.org/1245/3616_B_7_8.jpg Male 82 155 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_3.jpg http://images.proteinatlas.org/1245/3616_B_7_4.jpg Female 88 316 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_5.jpg http://images.proteinatlas.org/1245/3616_B_7_6.jpg Female 57 318 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_3.jpg http://images.proteinatlas.org/1245/3616_B_8_4.jpg Female 78 392 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_8.jpg Female 89 518 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_3.jpg http://images.proteinatlas.org/1245/3616_B_9_4.jpg Male 84 561 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_5.jpg http://images.proteinatlas.org/1245/3616_B_8_6.jpg Female 89 654 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_1.jpg http://images.proteinatlas.org/1245/3616_B_7_2.jpg Male 64 849 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_7.jpg http://images.proteinatlas.org/1245/3616_B_8_8.jpg Female 81 962 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_1.jpg Male 84 1246 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_1.jpg Male 75 1279 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_5.jpg http://images.proteinatlas.org/1245/3616_B_9_6.jpg Stomach cancer Tumor cells high medium low not detected Male 80 198 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_1.jpg http://images.proteinatlas.org/1245/3617_B_2_2.jpg Female 86 549 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_3.jpg http://images.proteinatlas.org/1245/3617_B_3_4.jpg Female 52 657 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_5.jpg http://images.proteinatlas.org/1245/3617_B_1_6.jpg Female 50 664 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_7.jpg http://images.proteinatlas.org/1245/3617_B_2_8.jpg Male 71 703 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_7.jpg http://images.proteinatlas.org/1245/3617_B_1_8.jpg Male 77 893 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_3.jpg http://images.proteinatlas.org/1245/3617_B_1_4.jpg Male 76 1073 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_3.jpg http://images.proteinatlas.org/1245/3617_B_2_4.jpg Male 88 1158 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_1.jpg http://images.proteinatlas.org/1245/3617_B_3_2.jpg Male 78 1186 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_1.jpg http://images.proteinatlas.org/1245/3617_B_1_2.jpg Male 63 1207 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_5.jpg http://images.proteinatlas.org/1245/3617_B_3_6.jpg Male 47 1266 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_5.jpg Male 74 2645 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_7.jpg http://images.proteinatlas.org/1245/3617_B_3_8.jpg Testis cancer Tumor cells high medium low Male 31 232 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_1.jpg http://images.proteinatlas.org/1245/3617_A_3_2.jpg Male 38 305 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_3.jpg http://images.proteinatlas.org/1245/3617_A_3_4.jpg Male 31 495 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_3.jpg http://images.proteinatlas.org/1245/3617_A_2_4.jpg Male 35 528 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_1.jpg http://images.proteinatlas.org/1245/3617_A_2_2.jpg Male 43 545 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_3.jpg http://images.proteinatlas.org/1245/3617_A_1_4.jpg Male 25 624 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_7.jpg http://images.proteinatlas.org/1245/3617_A_2_8.jpg Male 34 681 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_1.jpg http://images.proteinatlas.org/1245/3617_A_1_2.jpg Male 35 696 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_7.jpg http://images.proteinatlas.org/1245/3617_A_3_8.jpg Male 36 778 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_5.jpg http://images.proteinatlas.org/1245/3617_A_1_6.jpg Male 30 1005 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_5.jpg http://images.proteinatlas.org/1245/3617_A_2_6.jpg Male 33 1195 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_7.jpg http://images.proteinatlas.org/1245/3617_A_1_8.jpg Male 32 2718 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_5.jpg http://images.proteinatlas.org/1245/3617_A_3_6.jpg Thyroid cancer Tumor cells medium low not detected Male 76 306 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_1.jpg http://images.proteinatlas.org/1245/3616_A_3_2.jpg Male 87 348 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_7.jpg Female 71 923 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_3.jpg http://images.proteinatlas.org/1245/3616_A_3_4.jpg Female 71 985 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_5.jpg http://images.proteinatlas.org/1245/3616_A_3_6.jpg Urothelial cancer Tumor cells high medium low not detected Female 78 31 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_1.jpg http://images.proteinatlas.org/1245/3617_A_5_2.jpg Male 81 49 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_1.jpg http://images.proteinatlas.org/1245/3617_A_4_2.jpg Male 71 239 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_7.jpg http://images.proteinatlas.org/1245/3617_A_4_8.jpg Female 84 267 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_3.jpg http://images.proteinatlas.org/1245/3617_A_4_4.jpg Female 89 389 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_1.jpg http://images.proteinatlas.org/1245/3617_A_6_2.jpg Male 66 451 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_7.jpg http://images.proteinatlas.org/1245/3617_A_5_8.jpg Male 56 519 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_5.jpg http://images.proteinatlas.org/1245/3617_A_4_6.jpg Male 61 606 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_7.jpg http://images.proteinatlas.org/1245/3617_A_6_8.jpg Male 86 792 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_3.jpg http://images.proteinatlas.org/1245/3617_A_5_4.jpg Male 84 1096 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_5.jpg http://images.proteinatlas.org/1245/3617_A_5_6.jpg Male 54 1157 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_3.jpg http://images.proteinatlas.org/1245/3617_A_6_4.jpg Female 73 1204 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_5.jpg http://images.proteinatlas.org/1245/3617_A_6_6.jpg supported http://v21.proteinatlas.org/images_protein_array/1245_medium.png IGHG4 Intracellular, Membrane, Secreted (different isoforms)

approved Liver http://images.proteinatlas.org/1245/3618_A_9_4_rna_selected.jpg Colon http://images.proteinatlas.org/1245/3618_A_9_3_rna_selected.jpg Kidney http://images.proteinatlas.org/1245/3618_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/1245/3618_A_6_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/1245/3618_A_8_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/1245/3618_B_8_5_rna_selected.jpg Adipose tissue medium Adipocytes medium Adrenal gland medium Glandular cells medium Appendix medium Glandular cells not detected Lymphoid tissue medium Bone marrow high Hematopoietic cells high Breast medium Adipocytes medium Glandular cells not detected Myoepithelial cells not detected Bronchus low Respiratory epithelial cells low Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix low Glandular cells low Colon medium Endothelial cells medium Glandular cells not detected Duodenum low Glandular cells low Endometrium 1 medium Cells in endometrial stroma medium Glandular cells not detected Endometrium 2 medium Cells in endometrial stroma medium Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube low Glandular cells low Gallbladder low Glandular cells low Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney medium Cells in glomeruli medium Cells in tubules medium Liver medium Cholangiocytes not detected Hepatocytes medium Lung medium Alveolar cells medium Macrophages medium Lymph node low Germinal center cells low Non-germinal center cells low Oral mucosa low Squamous epithelial cells low Ovary medium Follicle cells low Ovarian stroma cells medium Pancreas medium Exocrine glandular cells medium Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta high Decidual cells not detected Trophoblastic cells high Prostate medium Glandular cells medium Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle low Glandular cells low Skeletal muscle low Myocytes low Skin 1 medium Fibroblasts not detected Keratinocytes not detected Langerhans medium Melanocytes low Skin 2 low Epidermal cells low Small intestine medium Glandular cells medium Smooth muscle not detected Smooth muscle cells not detected Soft tissue 2 not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 low Glandular cells low Stomach 2 not detected Glandular cells not detected Testis medium Cells in seminiferous ducts not detected Leydig cells medium Thyroid gland low Glandular cells low Tonsil high Germinal center cells low Non-germinal center cells high Squamous epithelial cells low Urinary bladder low Urothelial cells low Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 Detected in some RPMI-8226 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single B-cells Plasma cells Detected in some Plasma cells - Humoral immune response LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD

approved Medium consistency between antibody staining and RNA expression data Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/1245/ihc_selected.jpg Adipose tissue Adipocytes medium moderate >75% cytoplasmic/membranous Female 24 1856 http://images.proteinatlas.org/1245/3618_B_1_8.jpg Female 37 2174 http://images.proteinatlas.org/1245/3618_B_2_7.jpg Female 67 2208 http://images.proteinatlas.org/1245/3618_B_1_7.jpg Adrenal gland Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 71 1966 http://images.proteinatlas.org/1245/3618_B_6_5.jpg Male 35 2212 http://images.proteinatlas.org/1245/3618_B_4_5.jpg Female 44 2374 http://images.proteinatlas.org/1245/3618_B_5_5.jpg Appendix Glandular cells not detected weak <25% cytoplasmic/membranous Lymphoid tissue medium moderate 75%-25% cytoplasmic/membranous Male 38 2068 http://images.proteinatlas.org/1245/3618_A_2_2.jpg Female 66 2154 http://images.proteinatlas.org/1245/3618_A_3_2.jpg Female 9 2191 http://images.proteinatlas.org/1245/3618_A_1_2.jpg Bone marrow Hematopoietic cells high strong 75%-25% cytoplasmic/membranous Male 69 2673 http://images.proteinatlas.org/1245/3618_B_5_4.jpg Female 53 2674 http://images.proteinatlas.org/1245/3618_B_6_4.jpg Breast Adipocytes medium moderate >75% cytoplasmic/membranous Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 39 1801 http://images.proteinatlas.org/1245/3618_B_2_4.jpg Female 75 2042 http://images.proteinatlas.org/1245/3618_B_3_4.jpg Female 23 2259 http://images.proteinatlas.org/1245/3618_B_1_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 2100 http://images.proteinatlas.org/1245/3618_B_4_2.jpg Male 64 2317 http://images.proteinatlas.org/1245/3618_B_5_2.jpg Female 56 2336 http://images.proteinatlas.org/1245/3618_B_6_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/1245/3618_B_9_7.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/1245/3618_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_9_8.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected negative none none Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/1245/3618_B_7_5.jpg Male 77 1537 http://images.proteinatlas.org/1245/3618_B_9_5.jpg Female 45 1539 http://images.proteinatlas.org/1245/3618_B_8_5.jpg Cervix Glandular cells low weak 75%-25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/1245/3618_B_7_3.jpg Female 40 2200 http://images.proteinatlas.org/1245/3618_B_8_3.jpg Female 39 2380 http://images.proteinatlas.org/1245/3618_B_9_3.jpg Colon Endothelial cells medium moderate >75% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Female 61 1832 http://images.proteinatlas.org/1245/3618_A_9_3.jpg Duodenum Glandular cells low weak 75%-25% cytoplasmic/membranous Male 50 1904 http://images.proteinatlas.org/1245/3618_A_7_2.jpg Male 66 2329 http://images.proteinatlas.org/1245/3618_A_9_2.jpg Female 64 2338 http://images.proteinatlas.org/1245/3618_A_8_2.jpg Endometrium 1 Cells in endometrial stroma medium moderate >75% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/1245/3618_B_4_3.jpg Female 42 2242 http://images.proteinatlas.org/1245/3618_B_6_3.jpg Endometrium 2 Cells in endometrial stroma medium moderate 75%-25% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Female 72 1978 http://images.proteinatlas.org/1245/3618_B_2_3.jpg Female 61 2014 http://images.proteinatlas.org/1245/3618_B_1_3.jpg Epididymis Glandular cells not detected negative none none Male 36 1740 http://images.proteinatlas.org/1245/3618_A_3_6.jpg Male 26 1995 http://images.proteinatlas.org/1245/3618_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 62 2105 http://images.proteinatlas.org/1245/3618_B_5_1.jpg Fallopian tube Glandular cells low weak 75%-25% cytoplasmic/membranous Female 29 1830 http://images.proteinatlas.org/1245/3618_A_9_7.jpg Female 51 2389 http://images.proteinatlas.org/1245/3618_A_8_7.jpg Female 33 2394 http://images.proteinatlas.org/1245/3618_A_7_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Female 63 2201 http://images.proteinatlas.org/1245/3618_A_5_4.jpg Female 24 2381 http://images.proteinatlas.org/1245/3618_A_4_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 49 2278 http://images.proteinatlas.org/1245/3618_B_5_6.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_6_6.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_4_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/1245/3618_B_8_6.jpg Female 54 2523 http://images.proteinatlas.org/1245/3618_B_9_6.jpg Female 19 2524 http://images.proteinatlas.org/1245/3618_B_7_6.jpg Kidney Cells in glomeruli medium moderate 75%-25% cytoplasmic/membranous Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Female 56 1933 http://images.proteinatlas.org/1245/3618_A_7_5.jpg Male 28 1943 http://images.proteinatlas.org/1245/3618_A_8_5.jpg Male 7 2165 http://images.proteinatlas.org/1245/3618_A_9_5.jpg Liver Cholangiocytes not detected weak <25% cytoplasmic/membranous Hepatocytes medium moderate 75%-25% cytoplasmic/membranous Male 67 1720 http://images.proteinatlas.org/1245/3618_A_7_4.jpg Female 32 1846 http://images.proteinatlas.org/1245/3618_A_8_4.jpg Female 29 1899 http://images.proteinatlas.org/1245/3618_A_9_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Female 49 2268 http://images.proteinatlas.org/1245/3618_A_2_4.jpg Male 69 2373 http://images.proteinatlas.org/1245/3618_A_3_4.jpg Male 59 2417 http://images.proteinatlas.org/1245/3618_A_1_4.jpg Lymph node Germinal center cells low moderate <25% cytoplasmic/membranous Non-germinal center cells low weak 75%-25% cytoplasmic/membranous Male 46 2371 http://images.proteinatlas.org/1245/3618_A_7_8.jpg Male 3 2405 http://images.proteinatlas.org/1245/3618_A_8_8.jpg Oral mucosa Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Male 62 1505 http://images.proteinatlas.org/1245/3618_A_9_1.jpg Female 84 2406 http://images.proteinatlas.org/1245/3618_A_8_1.jpg Male 20 2519 http://images.proteinatlas.org/1245/3618_A_7_1.jpg Ovary Follicle cells low weak 75%-25% cytoplasmic/membranous Ovarian stroma cells medium moderate 75%-25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/1245/3618_A_5_7.jpg Female 33 2159 http://images.proteinatlas.org/1245/3618_A_6_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/1245/3618_A_1_3.jpg Female 43 2220 http://images.proteinatlas.org/1245/3618_A_2_3.jpg Male 66 2329 http://images.proteinatlas.org/1245/3618_A_3_3.jpg Parathyroid gland Glandular cells not detected weak <25% cytoplasmic/membranous Female 37 1889 http://images.proteinatlas.org/1245/3618_A_1_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells high strong >75% cytoplasmic/membranous Female 35 1814 http://images.proteinatlas.org/1245/3618_A_1_7.jpg Female 19 2169 http://images.proteinatlas.org/1245/3618_A_2_7.jpg Female 30 2515 http://images.proteinatlas.org/1245/3618_A_3_7.jpg Prostate Glandular cells medium moderate 75%-25% cytoplasmic/membranous Male 64 1938 http://images.proteinatlas.org/1245/3618_A_2_5.jpg Male 51 2053 http://images.proteinatlas.org/1245/3618_A_1_5.jpg Rectum Glandular cells not detected weak <25% cytoplasmic/membranous Female 46 1876 http://images.proteinatlas.org/1245/3618_A_4_3.jpg Male 92 2001 http://images.proteinatlas.org/1245/3618_A_5_3.jpg Female 66 2060 http://images.proteinatlas.org/1245/3618_A_6_3.jpg Salivary gland Glandular cells not detected negative none none Female 32 1364 http://images.proteinatlas.org/1245/3618_B_3_1.jpg Male 8 1636 http://images.proteinatlas.org/1245/3618_B_1_1.jpg Female 24 2323 http://images.proteinatlas.org/1245/3618_B_2_1.jpg Seminal vesicle Glandular cells low weak 75%-25% cytoplasmic/membranous Male 63 2017 http://images.proteinatlas.org/1245/3618_A_7_6.jpg Male 82 2023 http://images.proteinatlas.org/1245/3618_A_9_6.jpg Male 26 2254 http://images.proteinatlas.org/1245/3618_A_8_6.jpg Skeletal muscle Myocytes low moderate <25% cytoplasmic/membranous Male 62 1505 http://images.proteinatlas.org/1245/3618_B_3_6.jpg Female 37 1889 http://images.proteinatlas.org/1245/3618_B_1_6.jpg Female 58 2148 http://images.proteinatlas.org/1245/3618_B_2_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected weak <25% cytoplasmic/membranous Langerhans medium moderate >75% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 63 2418 http://images.proteinatlas.org/1245/3618_B_8_1.jpg Skin 2 Epidermal cells low weak 75%-25% cytoplasmic/membranous Female 68 1970 http://images.proteinatlas.org/1245/3618_B_5_8.jpg Female 15 2027 http://images.proteinatlas.org/1245/3618_B_4_8.jpg Female 78 2045 http://images.proteinatlas.org/1245/3618_B_6_8.jpg Small intestine Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 61 1839 http://images.proteinatlas.org/1245/3618_A_5_2.jpg Male 41 2226 http://images.proteinatlas.org/1245/3618_A_6_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 70 2118 http://images.proteinatlas.org/1245/3618_B_6_7.jpg Female 39 2225 http://images.proteinatlas.org/1245/3618_B_4_7.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 37 2174 http://images.proteinatlas.org/1245/3618_B_2_7.jpg Female 67 2208 http://images.proteinatlas.org/1245/3618_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Female 50 1632 http://images.proteinatlas.org/1245/3618_B_9_4.jpg Male 72 1714 http://images.proteinatlas.org/1245/3618_B_8_4.jpg Female 10 1905 http://images.proteinatlas.org/1245/3618_B_7_4.jpg Stomach 1 Glandular cells low moderate <25% cytoplasmic/membranous Male 42 1469 http://images.proteinatlas.org/1245/3618_A_5_1.jpg Male 76 2066 http://images.proteinatlas.org/1245/3618_A_6_1.jpg Female 56 2130 http://images.proteinatlas.org/1245/3618_A_4_1.jpg Stomach 2 Glandular cells not detected weak <25% cytoplasmic/membranous Male 76 2066 http://images.proteinatlas.org/1245/3618_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/1245/3618_A_1_1.jpg Female 73 2557 http://images.proteinatlas.org/1245/3618_A_3_1.jpg Testis Cells in seminiferous ducts not detected weak <25% cytoplasmic/membranous Leydig cells medium moderate >75% cytoplasmic/membranous Male 68 1880 http://images.proteinatlas.org/1245/3618_A_5_6.jpg Male 26 2071 http://images.proteinatlas.org/1245/3618_A_4_6.jpg Male 46 2435 http://images.proteinatlas.org/1245/3618_A_6_6.jpg Thyroid gland Glandular cells low moderate <25% cytoplasmic/membranous Female 75 1501 http://images.proteinatlas.org/1245/3618_B_3_5.jpg Male 61 2072 http://images.proteinatlas.org/1245/3618_B_2_5.jpg Female 22 2146 http://images.proteinatlas.org/1245/3618_B_1_5.jpg Tonsil Germinal center cells low moderate <25% cytoplasmic/membranous Non-germinal center cells high strong 75%-25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 40 2250 http://images.proteinatlas.org/1245/3618_A_6_8.jpg Male 31 2511 http://images.proteinatlas.org/1245/3618_A_4_8.jpg Urinary bladder Urothelial cells low weak 75%-25% cytoplasmic/membranous Female 55 2047 http://images.proteinatlas.org/1245/3618_A_6_5.jpg Male 51 2053 http://images.proteinatlas.org/1245/3618_A_4_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/1245/3618_B_1_2.jpg

Breast cancer Tumor cells medium low not detected Female 72 103 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_7.jpg http://images.proteinatlas.org/1245/3615_A_5_8.jpg Female 91 108 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_4_1.jpg http://images.proteinatlas.org/1245/3615_A_4_2.jpg Female 68 159 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_4_3.jpg http://images.proteinatlas.org/1245/3615_A_4_4.jpg Female 68 261 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_1.jpg http://images.proteinatlas.org/1245/3615_A_5_2.jpg Female 45 278 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_5.jpg http://images.proteinatlas.org/1245/3615_A_6_6.jpg Female 50 315 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_3.jpg Female 58 609 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_5_5.jpg http://images.proteinatlas.org/1245/3615_A_5_6.jpg Female 85 614 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_4_5.jpg http://images.proteinatlas.org/1245/3615_A_4_6.jpg Female 69 659 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_7.jpg http://images.proteinatlas.org/1245/3615_A_6_8.jpg Female 53 858 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_3.jpg http://images.proteinatlas.org/1245/3615_A_6_4.jpg Female 57 1044 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_6_1.jpg http://images.proteinatlas.org/1245/3615_A_6_2.jpg Female 56 1155 Not detected Negative None none http://images.proteinatlas.org/1245/3615_A_4_7.jpg Carcinoid Tumor cells high medium low Female 76 227 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_3.jpg http://images.proteinatlas.org/1245/3616_A_1_4.jpg Male 63 604 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_5.jpg http://images.proteinatlas.org/1245/3616_A_1_6.jpg Male 60 997 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_1.jpg http://images.proteinatlas.org/1245/3616_A_1_2.jpg Male 55 1092 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_1_7.jpg http://images.proteinatlas.org/1245/3616_A_1_8.jpg Cervical cancer Tumor cells medium low not detected Female 41 361 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_5.jpg http://images.proteinatlas.org/1245/3615_B_6_6.jpg Female 41 507 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_1.jpg http://images.proteinatlas.org/1245/3615_B_4_2.jpg Female 57 642 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_5.jpg http://images.proteinatlas.org/1245/3615_B_4_6.jpg Female 57 687 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_7.jpg http://images.proteinatlas.org/1245/3615_B_6_8.jpg Female 34 828 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_3.jpg http://images.proteinatlas.org/1245/3615_B_4_4.jpg Female 54 926 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_1.jpg http://images.proteinatlas.org/1245/3615_B_6_2.jpg Female 54 947 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_6_3.jpg http://images.proteinatlas.org/1245/3615_B_6_4.jpg Female 38 1071 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_7.jpg http://images.proteinatlas.org/1245/3615_B_5_8.jpg Female 31 1131 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_1.jpg http://images.proteinatlas.org/1245/3615_B_5_2.jpg Female 49 1187 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_4_7.jpg http://images.proteinatlas.org/1245/3615_B_4_8.jpg Female 45 1192 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_6.jpg Female 41 1267 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_5_3.jpg http://images.proteinatlas.org/1245/3615_B_5_4.jpg Colorectal cancer Tumor cells high medium low not detected Female 81 55 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_1.jpg http://images.proteinatlas.org/1245/3615_A_2_2.jpg Female 70 157 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_3.jpg http://images.proteinatlas.org/1245/3615_A_1_4.jpg Male 76 192 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_3.jpg http://images.proteinatlas.org/1245/3615_A_2_4.jpg Male 65 257 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_7.jpg http://images.proteinatlas.org/1245/3615_A_2_8.jpg Female 82 324 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_7.jpg http://images.proteinatlas.org/1245/3615_A_3_8.jpg Female 67 415 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_5.jpg http://images.proteinatlas.org/1245/3615_A_1_6.jpg Female 65 416 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_7.jpg http://images.proteinatlas.org/1245/3615_A_1_8.jpg Female 86 418 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_1.jpg http://images.proteinatlas.org/1245/3615_A_3_2.jpg Male 54 966 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_3.jpg http://images.proteinatlas.org/1245/3615_A_3_4.jpg Female 98 1184 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_1_1.jpg http://images.proteinatlas.org/1245/3615_A_1_2.jpg Female 57 1314 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_3_5.jpg http://images.proteinatlas.org/1245/3615_A_3_6.jpg Male 55 2633 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_2_5.jpg http://images.proteinatlas.org/1245/3615_A_2_6.jpg Endometrial cancer Tumor cells high medium low not detected Female 79 39 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/1245/3615_B_7_2.jpg Female 76 119 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_7_3.jpg http://images.proteinatlas.org/1245/3615_B_7_4.jpg Female 75 167 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_1.jpg http://images.proteinatlas.org/1245/3615_B_9_2.jpg Female 51 300 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_7_5.jpg http://images.proteinatlas.org/1245/3615_B_7_6.jpg Female 56 309 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_7_7.jpg http://images.proteinatlas.org/1245/3615_B_7_8.jpg Female 63 312 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_5.jpg http://images.proteinatlas.org/1245/3615_B_9_6.jpg Female 55 566 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_3.jpg http://images.proteinatlas.org/1245/3615_B_9_4.jpg Female 59 575 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_9_7.jpg http://images.proteinatlas.org/1245/3615_B_9_8.jpg Female 75 658 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_1.jpg Female 63 718 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_3.jpg http://images.proteinatlas.org/1245/3615_B_8_4.jpg Female 66 1164 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_5.jpg http://images.proteinatlas.org/1245/3615_B_8_6.jpg Female 75 1165 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_8_7.jpg http://images.proteinatlas.org/1245/3615_B_8_8.jpg Glioma Tumor cells high medium low not detected Male 68 3 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_6_1.jpg http://images.proteinatlas.org/1245/3616_A_6_2.jpg Female 36 34 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_5.jpg http://images.proteinatlas.org/1245/3616_A_4_6.jpg Male 36 38 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_7.jpg http://images.proteinatlas.org/1245/3616_A_4_8.jpg Male 72 45 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_3.jpg http://images.proteinatlas.org/1245/3616_A_5_4.jpg Male 77 46 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_6_3.jpg http://images.proteinatlas.org/1245/3616_A_6_4.jpg Female 60 105 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_7.jpg http://images.proteinatlas.org/1245/3616_A_5_8.jpg Female 15 158 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_6_7.jpg http://images.proteinatlas.org/1245/3616_A_6_8.jpg Female 46 176 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_6_5.jpg http://images.proteinatlas.org/1245/3616_A_6_6.jpg Male 48 183 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_5.jpg http://images.proteinatlas.org/1245/3616_A_5_6.jpg Male 69 191 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_5_1.jpg http://images.proteinatlas.org/1245/3616_A_5_2.jpg Male 66 206 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_3.jpg http://images.proteinatlas.org/1245/3616_A_4_4.jpg Female 37 221 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_4_1.jpg http://images.proteinatlas.org/1245/3616_A_4_2.jpg Head and neck cancer Tumor cells medium low not detected Female 74 807 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_1.jpg http://images.proteinatlas.org/1245/3616_A_2_2.jpg Female 82 903 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_3.jpg http://images.proteinatlas.org/1245/3616_A_2_4.jpg Male 70 1060 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_7.jpg http://images.proteinatlas.org/1245/3616_A_2_8.jpg Male 64 1130 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_2_5.jpg Liver cancer Tumor cells medium low not detected Female 66 82 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_1.jpg http://images.proteinatlas.org/1245/3617_B_7_2.jpg Female 55 490 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_3.jpg http://images.proteinatlas.org/1245/3617_B_8_4.jpg Female 79 516 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_5.jpg http://images.proteinatlas.org/1245/3617_B_8_6.jpg Female 52 812 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_7.jpg http://images.proteinatlas.org/1245/3617_B_8_8.jpg Male 49 929 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_3.jpg http://images.proteinatlas.org/1245/3617_B_7_4.jpg Female 65 937 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_1.jpg http://images.proteinatlas.org/1245/3617_B_9_2.jpg Female 79 1022 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_5.jpg http://images.proteinatlas.org/1245/3617_B_9_6.jpg Male 57 1175 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_7.jpg http://images.proteinatlas.org/1245/3617_B_9_8.jpg Male 69 1251 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_7.jpg http://images.proteinatlas.org/1245/3617_B_7_8.jpg Male 24 1287 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_8_1.jpg http://images.proteinatlas.org/1245/3617_B_8_2.jpg Male 47 2652 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_9_3.jpg http://images.proteinatlas.org/1245/3617_B_9_4.jpg Female 85 2662 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_7_5.jpg Lung cancer Tumor cells medium low not detected Male 64 376 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_7.jpg http://images.proteinatlas.org/1245/3616_B_2_8.jpg Male 75 385 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_1_5.jpg http://images.proteinatlas.org/1245/3616_B_1_6.jpg Male 48 426 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_1.jpg http://images.proteinatlas.org/1245/3616_B_2_2.jpg Male 60 461 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_3.jpg http://images.proteinatlas.org/1245/3616_B_2_4.jpg Female 75 496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_7.jpg http://images.proteinatlas.org/1245/3616_B_3_8.jpg Female 50 537 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_2_5.jpg http://images.proteinatlas.org/1245/3616_B_2_6.jpg Male 60 763 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_1_7.jpg http://images.proteinatlas.org/1245/3616_B_1_8.jpg Male 68 1048 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_1_4.jpg Male 71 1199 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_1.jpg http://images.proteinatlas.org/1245/3616_B_3_2.jpg Female 44 1249 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_3.jpg http://images.proteinatlas.org/1245/3616_B_3_4.jpg Male 68 1303 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_3_5.jpg http://images.proteinatlas.org/1245/3616_B_3_6.jpg Lymphoma Tumor cells medium low not detected Male 57 10 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_9_1.jpg http://images.proteinatlas.org/1245/3616_A_9_2.jpg Male 50 81 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_9_3.jpg http://images.proteinatlas.org/1245/3616_A_9_4.jpg Female 70 92 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_7_5.jpg http://images.proteinatlas.org/1245/3616_A_7_6.jpg Male 49 136 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_8_7.jpg http://images.proteinatlas.org/1245/3616_A_8_8.jpg Male 46 150 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_7_7.jpg http://images.proteinatlas.org/1245/3616_A_7_8.jpg Male 65 241 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_9_7.jpg http://images.proteinatlas.org/1245/3616_A_9_8.jpg Female 51 243 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_8_1.jpg http://images.proteinatlas.org/1245/3616_A_8_2.jpg Male 82 296 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_9_5.jpg http://images.proteinatlas.org/1245/3616_A_9_6.jpg Male 74 425 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_8_5.jpg http://images.proteinatlas.org/1245/3616_A_8_6.jpg Male 8 603 Not detected Negative None none http://images.proteinatlas.org/1245/3616_A_7_1.jpg Female 59 637 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_8_3.jpg http://images.proteinatlas.org/1245/3616_A_8_4.jpg Female 56 1090 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_7_3.jpg http://images.proteinatlas.org/1245/3616_A_7_4.jpg Melanoma Tumor cells high medium low not detected Female 85 165 Not detected Negative None none http://images.proteinatlas.org/1245/3616_B_4_7.jpg Male 88 212 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_6_5.jpg http://images.proteinatlas.org/1245/3616_B_6_6.jpg Male 75 363 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_4_1.jpg http://images.proteinatlas.org/1245/3616_B_4_2.jpg Female 82 379 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_4_5.jpg http://images.proteinatlas.org/1245/3616_B_4_6.jpg Female 64 656 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_5.jpg http://images.proteinatlas.org/1245/3616_B_5_6.jpg Male 56 744 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_4_3.jpg http://images.proteinatlas.org/1245/3616_B_4_4.jpg Male 23 761 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_6_1.jpg http://images.proteinatlas.org/1245/3616_B_6_2.jpg Male 57 791 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_1.jpg http://images.proteinatlas.org/1245/3616_B_5_2.jpg Female 73 1017 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_3.jpg http://images.proteinatlas.org/1245/3616_B_5_4.jpg Female 77 1189 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_5_7.jpg http://images.proteinatlas.org/1245/3616_B_5_8.jpg Female 49 1277 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_6_3.jpg http://images.proteinatlas.org/1245/3616_B_6_4.jpg Male 36 1301 Not detected Negative None none http://images.proteinatlas.org/1245/3616_B_6_7.jpg Ovarian cancer Tumor cells high medium low not detected Female 52 208 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_4.jpg Female 63 393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_1.jpg http://images.proteinatlas.org/1245/3615_B_3_2.jpg Female 71 592 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_7.jpg http://images.proteinatlas.org/1245/3615_B_2_8.jpg Female 85 785 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_1.jpg http://images.proteinatlas.org/1245/3615_B_2_2.jpg Female 57 825 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_1.jpg http://images.proteinatlas.org/1245/3615_B_1_2.jpg Female 84 1010 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_3.jpg http://images.proteinatlas.org/1245/3615_B_3_4.jpg Female 64 1016 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_5.jpg http://images.proteinatlas.org/1245/3615_B_3_6.jpg Female 41 1019 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_3.jpg http://images.proteinatlas.org/1245/3615_B_2_4.jpg Female 75 1106 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_7.jpg http://images.proteinatlas.org/1245/3615_B_1_8.jpg Female 77 1115 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_3_7.jpg http://images.proteinatlas.org/1245/3615_B_3_8.jpg Female 45 1116 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_1_5.jpg http://images.proteinatlas.org/1245/3615_B_1_6.jpg Female 25 1265 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_B_2_5.jpg http://images.proteinatlas.org/1245/3615_B_2_6.jpg Pancreatic cancer Tumor cells medium low not detected Female 52 170 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_3.jpg http://images.proteinatlas.org/1245/3617_B_5_4.jpg Female 66 317 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_3.jpg http://images.proteinatlas.org/1245/3617_B_4_4.jpg Male 70 582 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_5.jpg http://images.proteinatlas.org/1245/3617_B_6_6.jpg Female 64 646 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_1.jpg http://images.proteinatlas.org/1245/3617_B_5_2.jpg Female 70 823 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_7.jpg http://images.proteinatlas.org/1245/3617_B_5_8.jpg Female 70 834 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_1.jpg http://images.proteinatlas.org/1245/3617_B_4_2.jpg Male 77 893 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_8.jpg Male 59 969 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_1.jpg http://images.proteinatlas.org/1245/3617_B_6_2.jpg Female 57 977 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_4_5.jpg Male 62 1212 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_5_5.jpg http://images.proteinatlas.org/1245/3617_B_5_6.jpg Male 77 1248 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_3.jpg http://images.proteinatlas.org/1245/3617_B_6_4.jpg Male 79 2650 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_6_7.jpg http://images.proteinatlas.org/1245/3617_B_6_8.jpg Prostate cancer Tumor cells high medium low not detected Male 65 78 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_5.jpg http://images.proteinatlas.org/1245/3615_A_7_6.jpg Male 71 79 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_7.jpg http://images.proteinatlas.org/1245/3615_A_7_8.jpg Male 70 137 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_3.jpg http://images.proteinatlas.org/1245/3615_A_7_4.jpg Male 59 235 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_7_1.jpg http://images.proteinatlas.org/1245/3615_A_7_2.jpg Male 72 244 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_7.jpg http://images.proteinatlas.org/1245/3615_A_8_8.jpg Male 64 250 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_6.jpg Male 60 277 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_3.jpg http://images.proteinatlas.org/1245/3615_A_8_4.jpg Male 72 619 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_5.jpg http://images.proteinatlas.org/1245/3615_A_9_6.jpg Male 73 633 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_3.jpg http://images.proteinatlas.org/1245/3615_A_9_4.jpg Male 67 689 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_1.jpg http://images.proteinatlas.org/1245/3615_A_9_2.jpg Male 65 1089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_9_7.jpg http://images.proteinatlas.org/1245/3615_A_9_8.jpg Male 56 1234 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3615_A_8_1.jpg http://images.proteinatlas.org/1245/3615_A_8_2.jpg Renal cancer Tumor cells high medium low not detected Male 57 310 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_7.jpg http://images.proteinatlas.org/1245/3617_A_8_8.jpg Male 61 443 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_1.jpg http://images.proteinatlas.org/1245/3617_A_9_2.jpg Female 76 567 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_7.jpg http://images.proteinatlas.org/1245/3617_A_7_8.jpg Female 73 679 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_3.jpg http://images.proteinatlas.org/1245/3617_A_7_4.jpg Male 78 726 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_5.jpg http://images.proteinatlas.org/1245/3617_A_7_6.jpg Female 62 732 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_7_1.jpg http://images.proteinatlas.org/1245/3617_A_7_2.jpg Female 74 734 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_5.jpg http://images.proteinatlas.org/1245/3617_A_8_6.jpg Male 59 885 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_5.jpg http://images.proteinatlas.org/1245/3617_A_9_6.jpg Male 61 913 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_7.jpg http://images.proteinatlas.org/1245/3617_A_9_8.jpg Male 63 1134 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_9_3.jpg http://images.proteinatlas.org/1245/3617_A_9_4.jpg Female 52 1263 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_1.jpg http://images.proteinatlas.org/1245/3617_A_8_2.jpg Male 82 2635 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_8_3.jpg http://images.proteinatlas.org/1245/3617_A_8_4.jpg Skin cancer Tumor cells medium low not detected Male 63 35 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_7.jpg http://images.proteinatlas.org/1245/3616_B_7_8.jpg Male 82 155 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_3.jpg http://images.proteinatlas.org/1245/3616_B_7_4.jpg Female 88 316 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_5.jpg http://images.proteinatlas.org/1245/3616_B_7_6.jpg Female 57 318 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_3.jpg http://images.proteinatlas.org/1245/3616_B_8_4.jpg Female 78 392 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_8.jpg Female 89 518 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_3.jpg http://images.proteinatlas.org/1245/3616_B_9_4.jpg Male 84 561 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_5.jpg http://images.proteinatlas.org/1245/3616_B_8_6.jpg Female 89 654 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_7_1.jpg http://images.proteinatlas.org/1245/3616_B_7_2.jpg Male 64 849 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_7.jpg http://images.proteinatlas.org/1245/3616_B_8_8.jpg Female 81 962 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_8_1.jpg Male 84 1246 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_1.jpg Male 75 1279 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_B_9_5.jpg http://images.proteinatlas.org/1245/3616_B_9_6.jpg Stomach cancer Tumor cells high medium low not detected Male 80 198 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_1.jpg http://images.proteinatlas.org/1245/3617_B_2_2.jpg Female 86 549 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_3.jpg http://images.proteinatlas.org/1245/3617_B_3_4.jpg Female 52 657 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_5.jpg http://images.proteinatlas.org/1245/3617_B_1_6.jpg Female 50 664 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_7.jpg http://images.proteinatlas.org/1245/3617_B_2_8.jpg Male 71 703 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_7.jpg http://images.proteinatlas.org/1245/3617_B_1_8.jpg Male 77 893 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_3.jpg http://images.proteinatlas.org/1245/3617_B_1_4.jpg Male 76 1073 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_3.jpg http://images.proteinatlas.org/1245/3617_B_2_4.jpg Male 88 1158 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_1.jpg http://images.proteinatlas.org/1245/3617_B_3_2.jpg Male 78 1186 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_1_1.jpg http://images.proteinatlas.org/1245/3617_B_1_2.jpg Male 63 1207 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_5.jpg http://images.proteinatlas.org/1245/3617_B_3_6.jpg Male 47 1266 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_2_5.jpg Male 74 2645 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_B_3_7.jpg http://images.proteinatlas.org/1245/3617_B_3_8.jpg Testis cancer Tumor cells high medium low Male 31 232 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_1.jpg http://images.proteinatlas.org/1245/3617_A_3_2.jpg Male 38 305 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_3.jpg http://images.proteinatlas.org/1245/3617_A_3_4.jpg Male 31 495 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_3.jpg http://images.proteinatlas.org/1245/3617_A_2_4.jpg Male 35 528 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_1.jpg http://images.proteinatlas.org/1245/3617_A_2_2.jpg Male 43 545 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_3.jpg http://images.proteinatlas.org/1245/3617_A_1_4.jpg Male 25 624 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_7.jpg http://images.proteinatlas.org/1245/3617_A_2_8.jpg Male 34 681 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_1.jpg http://images.proteinatlas.org/1245/3617_A_1_2.jpg Male 35 696 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_7.jpg http://images.proteinatlas.org/1245/3617_A_3_8.jpg Male 36 778 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_5.jpg http://images.proteinatlas.org/1245/3617_A_1_6.jpg Male 30 1005 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_2_5.jpg http://images.proteinatlas.org/1245/3617_A_2_6.jpg Male 33 1195 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_1_7.jpg http://images.proteinatlas.org/1245/3617_A_1_8.jpg Male 32 2718 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_3_5.jpg http://images.proteinatlas.org/1245/3617_A_3_6.jpg Thyroid cancer Tumor cells medium low not detected Male 76 306 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_1.jpg http://images.proteinatlas.org/1245/3616_A_3_2.jpg Male 87 348 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_7.jpg Female 71 923 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_3.jpg http://images.proteinatlas.org/1245/3616_A_3_4.jpg Female 71 985 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3616_A_3_5.jpg http://images.proteinatlas.org/1245/3616_A_3_6.jpg Urothelial cancer Tumor cells high medium low not detected Female 78 31 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_1.jpg http://images.proteinatlas.org/1245/3617_A_5_2.jpg Male 81 49 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_1.jpg http://images.proteinatlas.org/1245/3617_A_4_2.jpg Male 71 239 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_7.jpg http://images.proteinatlas.org/1245/3617_A_4_8.jpg Female 84 267 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_3.jpg http://images.proteinatlas.org/1245/3617_A_4_4.jpg Female 89 389 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_1.jpg http://images.proteinatlas.org/1245/3617_A_6_2.jpg Male 66 451 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_7.jpg http://images.proteinatlas.org/1245/3617_A_5_8.jpg Male 56 519 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_4_5.jpg http://images.proteinatlas.org/1245/3617_A_4_6.jpg Male 61 606 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_7.jpg http://images.proteinatlas.org/1245/3617_A_6_8.jpg Male 86 792 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_3.jpg http://images.proteinatlas.org/1245/3617_A_5_4.jpg Male 84 1096 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_5_5.jpg http://images.proteinatlas.org/1245/3617_A_5_6.jpg Male 54 1157 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_3.jpg http://images.proteinatlas.org/1245/3617_A_6_4.jpg Female 73 1204 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/1245/3617_A_6_5.jpg http://images.proteinatlas.org/1245/3617_A_6_6.jpg supported http://v21.proteinatlas.org/images_protein_array/1245_medium.png IGHJ3 Intracellular Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer esophagus intestine pancreas Detected in many Pancreas - Digestion Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi RPMI-8226 TIME U-251 MG Detected in some TIME & HUVEC/TERT2 - Endothelial cell function A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 basophil naive B-cell Detected in many B-cells - Unknown function Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells granulocytes Detected in many Plasma cells Detected in single Plasma cells - Humoral immune response IGHJ5 Intracellular Not detected Not detected adipose tissue breast intestine prostate Detected in many Liver - Metabolism Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter HL-60 REH RH-30 Detected in some RH-30 & LHCN-M2 - Muscle contraction A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell Detected in many B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in single Plasma cells - Humoral immune response IGHM Intracellular, Membrane, Secreted (different isoforms)

uncertain Liver http://images.proteinatlas.org/8643/24789_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/8643/24789_A_9_3_rna_selected.jpg Kidney http://images.proteinatlas.org/8643/24789_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/8643/24789_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/8643/24789_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/8643/24789_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Detected in all Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Midbrain Olfactory bulb Pituitary gland Pons and medulla Retina Thalamus White matter Amygdala Caudate putamen Cerebellum Corpus callosum Entorhinal cortex Frontal cortex Hippocampal formation Hypothalamus Midbrain Occipital cortex Olfactory bulb Pituitary gland Pons and medulla Retina Retrosplenial and cingulate cortex Septum Somatosensory cortex Thalamus Ventral forebrain Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Olfactory bulb Pituitary gland Pons Retina Spinal cord Thalamus White matter Amygdala Caudate Cerebellum Cingulate cortex Corpus callosum Dorsal hippocampus Dorsal spinal cord Entorhinal cortex Hypothalamus Insular cortex Medulla oblongata Midbrain Motor cortex Occipital cortex Olfactory bulb Periaqueductal gray Pituitary gland Pons Prefrontal cortex Putamen Retina Retrosplenial cortex Septum Somatosensory cortex Subiculum Substantia nigra Superior colliculi Temporal cortex Thalamus Ventral hippocampus Ventral pallidum Ventral spinal cord Daudi U-698 Detected in many U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in all B-cells - Adaptive immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in all B-cells Plasma cells Detected in many Plasma cells - Humoral immune response

uncertain No tissue staining or RNA expression data available for comparison Not done http://images.proteinatlas.org/8643/ihc_selected.jpg Adipose tissue Adipocytes medium moderate >75% cytoplasmic/membranous Male 52 1879 http://images.proteinatlas.org/8643/24789_B_2_8.jpg Male 62 2142 http://images.proteinatlas.org/8643/24789_B_3_8.jpg Female 25 2419 http://images.proteinatlas.org/8643/24789_B_1_7.jpg Female 35 2587 http://images.proteinatlas.org/8643/24789_B_2_7.jpg Female 73 3144 http://images.proteinatlas.org/8643/24789_B_1_8.jpg Male 70 3356 http://images.proteinatlas.org/8643/24789_B_3_7.jpg Adrenal gland Glandular cells low moderate <25% cytoplasmic/membranous Female 47 2741 http://images.proteinatlas.org/8643/24789_B_5_5.jpg Female 57 3061 http://images.proteinatlas.org/8643/24789_B_4_5.jpg Male 56 3444 http://images.proteinatlas.org/8643/24789_B_6_5.jpg Appendix Glandular cells high strong 75%-25% cytoplasmic/membranous Lymphoid tissue not detected weak <25% cytoplasmic/membranous Female 20 2444 http://images.proteinatlas.org/8643/24789_A_1_2.jpg Male 52 2761 http://images.proteinatlas.org/8643/24789_A_3_2.jpg Bone marrow Hematopoietic cells medium strong <25% cytoplasmic/membranous Male 42 3425 http://images.proteinatlas.org/8643/24789_B_5_4.jpg Female 17 3439 http://images.proteinatlas.org/8643/24789_B_4_4.jpg Female 76 3442 http://images.proteinatlas.org/8643/24789_B_6_4.jpg Breast Adipocytes not detected negative none none Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 75 2042 http://images.proteinatlas.org/8643/24789_B_3_4.jpg Female 23 2773 http://images.proteinatlas.org/8643/24789_B_1_4.jpg Female 27 3286 http://images.proteinatlas.org/8643/24789_B_2_4.jpg Bronchus Respiratory epithelial cells medium strong <25% cytoplasmic/membranous Male 64 2317 http://images.proteinatlas.org/8643/24789_B_6_2.jpg Female 54 2393 http://images.proteinatlas.org/8643/24789_B_4_2.jpg Male 66 3185 http://images.proteinatlas.org/8643/24789_B_5_2.jpg Caudate Glial cells medium moderate 75%-25% cytoplasmic/membranous Neuronal cells medium moderate 75%-25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/8643/24789_B_9_7.jpg Female 54 2523 http://images.proteinatlas.org/8643/24789_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/8643/24789_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer medium strong <25% cytoplasmic/membranous Purkinje cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/8643/24789_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/8643/24789_B_9_8.jpg Female 19 2524 http://images.proteinatlas.org/8643/24789_B_8_8.jpg Cerebral cortex Endothelial cells high strong >75% cytoplasmic/membranous Glial cells low moderate <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Neuropil not detected negative none none Male 62 1609 http://images.proteinatlas.org/8643/24789_B_8_5.jpg Male 45 2521 http://images.proteinatlas.org/8643/24789_B_7_5.jpg Female 54 2523 http://images.proteinatlas.org/8643/24789_B_9_5.jpg Cervix Glandular cells not detected negative none none Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Female 55 2005 http://images.proteinatlas.org/8643/24789_B_8_3.jpg Female 65 2434 http://images.proteinatlas.org/8643/24789_B_7_3.jpg Female 39 3313 http://images.proteinatlas.org/8643/24789_B_9_3.jpg Colon Endothelial cells not detected negative none none Glandular cells medium moderate 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 80 2944 http://images.proteinatlas.org/8643/24789_A_9_3.jpg Male 73 3266 http://images.proteinatlas.org/8643/24789_A_8_3.jpg Duodenum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Male 50 1904 http://images.proteinatlas.org/8643/24789_A_7_2.jpg Male 54 2562 http://images.proteinatlas.org/8643/24789_A_9_2.jpg Female 71 3004 http://images.proteinatlas.org/8643/24789_A_8_2.jpg Endometrium 1 Cells in endometrial stroma high strong >75% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 42 2242 http://images.proteinatlas.org/8643/24789_B_5_3.jpg Female 33 2941 http://images.proteinatlas.org/8643/24789_B_6_3.jpg Female 35 3333 http://images.proteinatlas.org/8643/24789_B_4_3.jpg Endometrium 2 Cells in endometrial stroma medium moderate 75%-25% cytoplasmic/membranous Glandular cells low moderate <25% cytoplasmic/membranous Female 72 1978 http://images.proteinatlas.org/8643/24789_B_2_3.jpg Female 61 3323 http://images.proteinatlas.org/8643/24789_B_1_3.jpg Female 51 3491 http://images.proteinatlas.org/8643/24789_B_3_3.jpg Epididymis Glandular cells low moderate <25% cytoplasmic/membranous Male 36 1740 http://images.proteinatlas.org/8643/24789_A_3_6.jpg Male 56 3355 http://images.proteinatlas.org/8643/24789_A_1_6.jpg Esophagus Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 72 2794 http://images.proteinatlas.org/8643/24789_B_4_1.jpg Male 48 3044 http://images.proteinatlas.org/8643/24789_B_6_1.jpg Male 54 3197 http://images.proteinatlas.org/8643/24789_B_5_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 71 1972 http://images.proteinatlas.org/8643/24789_A_7_7.jpg Female 46 2379 http://images.proteinatlas.org/8643/24789_A_9_7.jpg Female 34 2382 http://images.proteinatlas.org/8643/24789_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Female 64 2025 http://images.proteinatlas.org/8643/24789_A_5_4.jpg Female 26 2446 http://images.proteinatlas.org/8643/24789_A_4_4.jpg Male 54 2562 http://images.proteinatlas.org/8643/24789_A_6_4.jpg Heart muscle Cardiomyocytes medium moderate 75%-25% cytoplasmic/membranous,nuclear Male 45 2521 http://images.proteinatlas.org/8643/24789_B_4_6.jpg Female 54 2523 http://images.proteinatlas.org/8643/24789_B_5_6.jpg Female 19 2524 http://images.proteinatlas.org/8643/24789_B_6_6.jpg Hippocampus Glial cells medium moderate 75%-25% cytoplasmic/membranous Neuronal cells medium moderate 75%-25% cytoplasmic/membranous Female 54 2523 http://images.proteinatlas.org/8643/24789_B_8_6.jpg Female 19 2524 http://images.proteinatlas.org/8643/24789_B_7_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules not detected negative none none Female 56 1933 http://images.proteinatlas.org/8643/24789_A_9_5.jpg Male 7 2165 http://images.proteinatlas.org/8643/24789_A_8_5.jpg Male 59 3229 http://images.proteinatlas.org/8643/24789_A_7_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes low moderate <25% cytoplasmic/membranous Female 32 1846 http://images.proteinatlas.org/8643/24789_A_7_4.jpg Male 55 2429 http://images.proteinatlas.org/8643/24789_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/8643/24789_A_9_4.jpg Lung Alveolar cells medium strong <25% cytoplasmic/membranous,nuclear Macrophages low weak 75%-25% cytoplasmic/membranous Male 21 2101 http://images.proteinatlas.org/8643/24789_A_1_4.jpg Male 59 2222 http://images.proteinatlas.org/8643/24789_A_3_4.jpg Female 49 2268 http://images.proteinatlas.org/8643/24789_A_2_4.jpg Lymph node Germinal center cells medium moderate 75%-25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Male 63 1638 http://images.proteinatlas.org/8643/24789_A_8_8.jpg Male 55 1724 http://images.proteinatlas.org/8643/24789_A_7_8.jpg Female 14 2458 http://images.proteinatlas.org/8643/24789_A_9_8.jpg Nasopharynx Respiratory epithelial cells low moderate <25% cytoplasmic/membranous Female 51 2700 http://images.proteinatlas.org/8643/24789_B_9_2.jpg Male 22 3362 http://images.proteinatlas.org/8643/24789_B_7_2.jpg Oral mucosa Squamous epithelial cells high strong 75%-25% cytoplasmic/membranous Male 71 1711 http://images.proteinatlas.org/8643/24789_A_9_1.jpg Female 84 2406 http://images.proteinatlas.org/8643/24789_A_8_1.jpg Male 58 3135 http://images.proteinatlas.org/8643/24789_A_7_1.jpg Ovary Ovarian stroma cells low moderate <25% cytoplasmic/membranous Female 33 2159 http://images.proteinatlas.org/8643/24789_A_4_7.jpg Female 60 2264 http://images.proteinatlas.org/8643/24789_A_5_7.jpg Female 35 2344 http://images.proteinatlas.org/8643/24789_A_6_7.jpg Pancreas Exocrine glandular cells low moderate <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/8643/24789_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/8643/24789_A_1_3.jpg Female 70 3320 http://images.proteinatlas.org/8643/24789_A_2_3.jpg Parathyroid gland Glandular cells medium strong <25% cytoplasmic/membranous Female 64 2995 http://images.proteinatlas.org/8643/24789_A_3_8.jpg Male 44 3502 http://images.proteinatlas.org/8643/24789_A_1_8.jpg Placenta Decidual cells medium moderate 75%-25% cytoplasmic/membranous Trophoblastic cells medium moderate 75%-25% cytoplasmic/membranous Female 35 1814 http://images.proteinatlas.org/8643/24789_A_2_7.jpg Female 19 2169 http://images.proteinatlas.org/8643/24789_A_1_7.jpg Female 30 2903 http://images.proteinatlas.org/8643/24789_A_3_7.jpg Prostate Glandular cells not detected negative none none Male 51 2053 http://images.proteinatlas.org/8643/24789_A_3_5.jpg Male 60 2098 http://images.proteinatlas.org/8643/24789_A_2_5.jpg Male 76 2932 http://images.proteinatlas.org/8643/24789_A_1_5.jpg Rectum Glandular cells high strong 75%-25% cytoplasmic/membranous Female 66 2060 http://images.proteinatlas.org/8643/24789_A_5_3.jpg Male 44 3231 http://images.proteinatlas.org/8643/24789_A_4_3.jpg Female 24 3364 http://images.proteinatlas.org/8643/24789_A_6_3.jpg Salivary gland Glandular cells not detected negative none none Female 24 2323 http://images.proteinatlas.org/8643/24789_B_1_1.jpg Male 62 2367 http://images.proteinatlas.org/8643/24789_B_2_1.jpg Male 3 2405 http://images.proteinatlas.org/8643/24789_B_3_1.jpg Seminal vesicle Glandular cells low moderate <25% cytoplasmic/membranous Male 51 2053 http://images.proteinatlas.org/8643/24789_A_9_6.jpg Male 61 2625 http://images.proteinatlas.org/8643/24789_A_8_6.jpg Male 46 3186 http://images.proteinatlas.org/8643/24789_A_7_6.jpg Skeletal muscle Myocytes low weak 75%-25% cytoplasmic/membranous Male 83 2360 http://images.proteinatlas.org/8643/24789_B_2_6.jpg Female 84 2406 http://images.proteinatlas.org/8643/24789_B_1_6.jpg Male 51 2608 http://images.proteinatlas.org/8643/24789_B_3_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans not detected negative none none Melanocytes not detected negative none none Female 17 2426 http://images.proteinatlas.org/8643/24789_B_9_1.jpg Male 16 2549 http://images.proteinatlas.org/8643/24789_B_7_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Male 69 3263 http://images.proteinatlas.org/8643/24789_B_6_8.jpg Female 54 3403 http://images.proteinatlas.org/8643/24789_B_4_8.jpg Small intestine Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 61 1839 http://images.proteinatlas.org/8643/24789_A_5_2.jpg Male 41 2226 http://images.proteinatlas.org/8643/24789_A_6_2.jpg Smooth muscle Smooth muscle cells not detected weak <25% nuclear Male 16 1767 http://images.proteinatlas.org/8643/24789_B_6_7.jpg Female 33 2175 http://images.proteinatlas.org/8643/24789_B_4_7.jpg Female 65 2434 http://images.proteinatlas.org/8643/24789_B_5_7.jpg Soft tissue 1 Chondrocytes low weak 75%-25% cytoplasmic/membranous Fibroblasts low weak >75% cytoplasmic/membranous Male 52 1879 http://images.proteinatlas.org/8643/24789_B_2_8.jpg Male 62 2142 http://images.proteinatlas.org/8643/24789_B_3_8.jpg Female 73 3144 http://images.proteinatlas.org/8643/24789_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 25 2419 http://images.proteinatlas.org/8643/24789_B_1_7.jpg Female 35 2587 http://images.proteinatlas.org/8643/24789_B_2_7.jpg Male 70 3356 http://images.proteinatlas.org/8643/24789_B_3_7.jpg Spleen Cells in red pulp medium strong <25% cytoplasmic/membranous Cells in white pulp medium moderate 75%-25% cytoplasmic/membranous Male 72 1714 http://images.proteinatlas.org/8643/24789_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/8643/24789_B_9_4.jpg Male 36 2940 http://images.proteinatlas.org/8643/24789_B_8_4.jpg Stomach 1 Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 56 2130 http://images.proteinatlas.org/8643/24789_A_5_1.jpg Male 68 2471 http://images.proteinatlas.org/8643/24789_A_6_1.jpg Male 72 2583 http://images.proteinatlas.org/8643/24789_A_4_1.jpg Stomach 2 Glandular cells high strong 75%-25% cytoplasmic/membranous Female 76 57 http://images.proteinatlas.org/8643/24789_A_3_1.jpg Female 75 1534 http://images.proteinatlas.org/8643/24789_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/8643/24789_A_1_1.jpg Testis Cells in seminiferous ducts low moderate <25% cytoplasmic/membranous Leydig cells medium moderate 75%-25% cytoplasmic/membranous Male 68 1880 http://images.proteinatlas.org/8643/24789_A_5_6.jpg Male 26 2071 http://images.proteinatlas.org/8643/24789_A_4_6.jpg Male 46 2435 http://images.proteinatlas.org/8643/24789_A_6_6.jpg Thyroid gland Glandular cells low moderate <25% cytoplasmic/membranous Male 61 2072 http://images.proteinatlas.org/8643/24789_B_2_5.jpg Female 86 2594 http://images.proteinatlas.org/8643/24789_B_1_5.jpg Female 44 3005 http://images.proteinatlas.org/8643/24789_B_3_5.jpg Tonsil Germinal center cells high strong 75%-25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells high strong 75%-25% cytoplasmic/membranous Female 40 2250 http://images.proteinatlas.org/8643/24789_A_6_8.jpg Male 17 2615 http://images.proteinatlas.org/8643/24789_A_5_8.jpg Female 19 3294 http://images.proteinatlas.org/8643/24789_A_4_8.jpg Urinary bladder Urothelial cells not detected weak <25% cytoplasmic/membranous Male 46 3186 http://images.proteinatlas.org/8643/24789_A_5_5.jpg Male 55 3316 http://images.proteinatlas.org/8643/24789_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 34 1751 http://images.proteinatlas.org/8643/24789_B_1_2.jpg Female 44 2480 http://images.proteinatlas.org/8643/24789_B_2_2.jpg Female 61 3015 http://images.proteinatlas.org/8643/24789_B_3_2.jpg

Breast cancer Tumor cells medium low not detected Female 40 1838 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_5_3.jpg http://images.proteinatlas.org/8643/24786_A_5_4.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_6_2.jpg Female 46 1882 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_4_3.jpg http://images.proteinatlas.org/8643/24786_A_4_4.jpg Female 61 1910 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_6_7.jpg http://images.proteinatlas.org/8643/24786_A_6_8.jpg Female 87 1939 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_6_5.jpg http://images.proteinatlas.org/8643/24786_A_6_6.jpg Female 50 1977 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_5_7.jpg Female 51 2083 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_4_5.jpg http://images.proteinatlas.org/8643/24786_A_4_6.jpg Female 40 2091 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_4_7.jpg http://images.proteinatlas.org/8643/24786_A_4_8.jpg Female 60 2199 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_5_1.jpg http://images.proteinatlas.org/8643/24786_A_5_2.jpg Female 27 2392 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_6_3.jpg http://images.proteinatlas.org/8643/24786_A_6_4.jpg Female 41 2898 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_4_1.jpg http://images.proteinatlas.org/8643/24786_A_4_2.jpg Carcinoid Tumor cells medium low not detected Male 60 1425 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_1_3.jpg http://images.proteinatlas.org/8643/24787_A_1_4.jpg Female 54 2088 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_1_5.jpg http://images.proteinatlas.org/8643/24787_A_1_6.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_1_7.jpg http://images.proteinatlas.org/8643/24787_A_1_8.jpg Male 30 3171 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_1_1.jpg http://images.proteinatlas.org/8643/24787_A_1_2.jpg Cervical cancer Tumor cells high medium low not detected Female 40 978 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_6_3.jpg http://images.proteinatlas.org/8643/24786_B_6_4.jpg Female 39 1716 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_4_3.jpg http://images.proteinatlas.org/8643/24786_B_4_4.jpg Female 34 1751 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_5_1.jpg http://images.proteinatlas.org/8643/24786_B_5_2.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_4_5.jpg http://images.proteinatlas.org/8643/24786_B_4_6.jpg Female 44 2480 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_5_5.jpg http://images.proteinatlas.org/8643/24786_B_5_6.jpg Female 44 2528 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_6_7.jpg http://images.proteinatlas.org/8643/24786_B_6_8.jpg Female 32 2841 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_4_2.jpg Female 38 2988 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_6_1.jpg http://images.proteinatlas.org/8643/24786_B_6_2.jpg Female 35 3333 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_4_7.jpg http://images.proteinatlas.org/8643/24786_B_4_8.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_6_5.jpg http://images.proteinatlas.org/8643/24786_B_6_6.jpg Female 46 3400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_5_7.jpg http://images.proteinatlas.org/8643/24786_B_5_8.jpg Female 63 3409 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_5_3.jpg http://images.proteinatlas.org/8643/24786_B_5_4.jpg Colorectal cancer Tumor cells medium low not detected Male 55 349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_1_3.jpg http://images.proteinatlas.org/8643/24786_A_1_4.jpg Male 45 693 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_2_7.jpg http://images.proteinatlas.org/8643/24786_A_2_8.jpg Male 71 1898 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_2_3.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_1_5.jpg http://images.proteinatlas.org/8643/24786_A_1_6.jpg Male 92 2001 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_2_2.jpg Female 66 2060 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_3_7.jpg http://images.proteinatlas.org/8643/24786_A_3_8.jpg Male 72 2096 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_3_3.jpg http://images.proteinatlas.org/8643/24786_A_3_4.jpg Female 86 2106 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_1_2.jpg Female 75 2151 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_3_5.jpg http://images.proteinatlas.org/8643/24786_A_3_6.jpg Female 77 2468 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_3_1.jpg http://images.proteinatlas.org/8643/24786_A_3_2.jpg Female 57 2619 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_2_5.jpg http://images.proteinatlas.org/8643/24786_A_2_6.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1379 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_7_7.jpg http://images.proteinatlas.org/8643/24786_B_7_8.jpg Female 83 1750 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_9_7.jpg http://images.proteinatlas.org/8643/24786_B_9_8.jpg Female 53 1766 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_8_7.jpg http://images.proteinatlas.org/8643/24786_B_8_8.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_9_1.jpg http://images.proteinatlas.org/8643/24786_B_9_2.jpg Female 70 2118 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_7_1.jpg http://images.proteinatlas.org/8643/24786_B_7_2.jpg Female 79 2339 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_9_4.jpg Female 58 2455 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_8_1.jpg http://images.proteinatlas.org/8643/24786_B_8_2.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_8_6.jpg Female 63 2772 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_7_3.jpg http://images.proteinatlas.org/8643/24786_B_7_4.jpg Female 85 3319 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_7_5.jpg http://images.proteinatlas.org/8643/24786_B_7_6.jpg Female 70 3367 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_8_3.jpg http://images.proteinatlas.org/8643/24786_B_8_4.jpg Glioma Tumor cells high medium low not detected Male 77 1537 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_5_7.jpg http://images.proteinatlas.org/8643/24787_A_5_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_4_1.jpg http://images.proteinatlas.org/8643/24787_A_4_2.jpg Male 33 1627 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_6_3.jpg http://images.proteinatlas.org/8643/24787_A_6_4.jpg Male 60 2726 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_6_1.jpg http://images.proteinatlas.org/8643/24787_A_6_2.jpg Male 47 2750 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_6_5.jpg http://images.proteinatlas.org/8643/24787_A_6_6.jpg Male 71 3091 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_6_7.jpg http://images.proteinatlas.org/8643/24787_A_6_8.jpg Male 48 3092 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_5_5.jpg http://images.proteinatlas.org/8643/24787_A_5_6.jpg Male 38 3120 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_4_3.jpg http://images.proteinatlas.org/8643/24787_A_4_4.jpg Male 77 3137 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_4_5.jpg http://images.proteinatlas.org/8643/24787_A_4_6.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_5_1.jpg http://images.proteinatlas.org/8643/24787_A_5_2.jpg Female 58 3241 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_4_7.jpg http://images.proteinatlas.org/8643/24787_A_4_8.jpg Head and neck cancer Tumor cells medium low Female 59 773 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_2_7.jpg http://images.proteinatlas.org/8643/24787_A_2_8.jpg Female 55 797 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_2_5.jpg http://images.proteinatlas.org/8643/24787_A_2_6.jpg Male 62 1743 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_2_3.jpg http://images.proteinatlas.org/8643/24787_A_2_4.jpg Male 51 2608 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_2_1.jpg http://images.proteinatlas.org/8643/24787_A_2_2.jpg Liver cancer Tumor cells high medium low not detected Female 65 282 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_9_7.jpg http://images.proteinatlas.org/8643/24788_B_9_8.jpg Female 65 937 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_7_5.jpg http://images.proteinatlas.org/8643/24788_B_7_6.jpg Male 55 1163 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_8_5.jpg http://images.proteinatlas.org/8643/24788_B_8_6.jpg Female 55 1252 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_9_5.jpg http://images.proteinatlas.org/8643/24788_B_9_6.jpg Female 58 2177 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_8_1.jpg http://images.proteinatlas.org/8643/24788_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_7_1.jpg Male 80 2280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_9_1.jpg Female 52 2399 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_8_7.jpg http://images.proteinatlas.org/8643/24788_B_8_8.jpg Male 72 2556 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_9_3.jpg http://images.proteinatlas.org/8643/24788_B_9_4.jpg Male 50 2578 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_8_3.jpg http://images.proteinatlas.org/8643/24788_B_8_4.jpg Female 73 2766 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_7_7.jpg http://images.proteinatlas.org/8643/24788_B_7_8.jpg Female 61 3215 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_7_3.jpg http://images.proteinatlas.org/8643/24788_B_7_4.jpg Lung cancer Tumor cells high medium low not detected Male 57 1428 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_2_3.jpg http://images.proteinatlas.org/8643/24787_B_2_4.jpg Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_1_7.jpg http://images.proteinatlas.org/8643/24787_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_3_5.jpg http://images.proteinatlas.org/8643/24787_B_3_6.jpg Female 51 2041 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_3_2.jpg Male 66 2050 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_2_5.jpg http://images.proteinatlas.org/8643/24787_B_2_6.jpg Female 47 2100 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_1_5.jpg http://images.proteinatlas.org/8643/24787_B_1_6.jpg Male 71 2231 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_2_7.jpg http://images.proteinatlas.org/8643/24787_B_2_8.jpg Female 65 2403 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_3_3.jpg http://images.proteinatlas.org/8643/24787_B_3_4.jpg Male 54 2796 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_3_7.jpg http://images.proteinatlas.org/8643/24787_B_3_8.jpg Male 49 3003 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_2_1.jpg http://images.proteinatlas.org/8643/24787_B_2_2.jpg Female 73 3016 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_1_3.jpg http://images.proteinatlas.org/8643/24787_B_1_4.jpg Female 70 3391 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_1_1.jpg http://images.proteinatlas.org/8643/24787_B_1_2.jpg Lymphoma Tumor cells high medium low not detected Female 50 1596 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_7_7.jpg http://images.proteinatlas.org/8643/24787_A_7_8.jpg Female 36 1606 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_7_5.jpg http://images.proteinatlas.org/8643/24787_A_7_6.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_7_1.jpg http://images.proteinatlas.org/8643/24787_A_7_2.jpg Female 19 1734 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_8_7.jpg http://images.proteinatlas.org/8643/24787_A_8_8.jpg Male 18 2604 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_9_7.jpg http://images.proteinatlas.org/8643/24787_A_9_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_9_1.jpg http://images.proteinatlas.org/8643/24787_A_9_2.jpg Female 67 2751 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_9_5.jpg Male 83 2883 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_8_1.jpg http://images.proteinatlas.org/8643/24787_A_8_2.jpg Female 76 3010 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_8_5.jpg http://images.proteinatlas.org/8643/24787_A_8_6.jpg Female 77 3018 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_7_3.jpg http://images.proteinatlas.org/8643/24787_A_7_4.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_8_3.jpg http://images.proteinatlas.org/8643/24787_A_8_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_9_3.jpg http://images.proteinatlas.org/8643/24787_A_9_4.jpg Melanoma Tumor cells high medium low not detected Male 59 1414 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_6_5.jpg http://images.proteinatlas.org/8643/24787_B_6_6.jpg Male 61 1482 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_6_7.jpg http://images.proteinatlas.org/8643/24787_B_6_8.jpg Male 41 2112 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_5_7.jpg http://images.proteinatlas.org/8643/24787_B_5_8.jpg Female 87 2136 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_4_5.jpg http://images.proteinatlas.org/8643/24787_B_4_6.jpg Male 53 2534 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_4_1.jpg http://images.proteinatlas.org/8643/24787_B_4_2.jpg Female 30 2598 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_5_5.jpg http://images.proteinatlas.org/8643/24787_B_5_6.jpg Female 73 2900 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_4_8.jpg Female 82 3060 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_6_1.jpg http://images.proteinatlas.org/8643/24787_B_6_2.jpg Female 81 3210 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_4_3.jpg http://images.proteinatlas.org/8643/24787_B_4_4.jpg Female 46 3223 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_6_3.jpg http://images.proteinatlas.org/8643/24787_B_6_4.jpg Female 64 3260 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_5_1.jpg http://images.proteinatlas.org/8643/24787_B_5_2.jpg Male 59 3351 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_5_3.jpg http://images.proteinatlas.org/8643/24787_B_5_4.jpg Ovarian cancer Tumor cells medium low not detected Female 37 857 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_2_7.jpg http://images.proteinatlas.org/8643/24786_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_2_3.jpg http://images.proteinatlas.org/8643/24786_B_2_4.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_3_5.jpg http://images.proteinatlas.org/8643/24786_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_2_1.jpg http://images.proteinatlas.org/8643/24786_B_2_2.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_1_1.jpg http://images.proteinatlas.org/8643/24786_B_1_2.jpg Female 69 2391 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_3_7.jpg http://images.proteinatlas.org/8643/24786_B_3_8.jpg Female 62 2568 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_1_3.jpg http://images.proteinatlas.org/8643/24786_B_1_4.jpg Female 80 2747 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_3_3.jpg http://images.proteinatlas.org/8643/24786_B_3_4.jpg Female 79 2889 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_1_5.jpg http://images.proteinatlas.org/8643/24786_B_1_6.jpg Female 56 3115 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_B_3_1.jpg http://images.proteinatlas.org/8643/24786_B_3_2.jpg Female 44 3146 Not detected Negative None none http://images.proteinatlas.org/8643/24786_B_1_7.jpg http://images.proteinatlas.org/8643/24786_B_1_8.jpg Pancreatic cancer Tumor cells medium low not detected Female 77 195 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_4_5.jpg http://images.proteinatlas.org/8643/24788_B_4_6.jpg Male 70 582 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_6_7.jpg Male 59 628 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_5_7.jpg http://images.proteinatlas.org/8643/24788_B_5_8.jpg Female 64 646 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_5_5.jpg http://images.proteinatlas.org/8643/24788_B_5_6.jpg Male 70 729 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_6_3.jpg http://images.proteinatlas.org/8643/24788_B_6_4.jpg Female 70 834 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_5_3.jpg Male 50 1156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_4_7.jpg Male 63 1647 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_4_1.jpg http://images.proteinatlas.org/8643/24788_B_4_2.jpg Male 50 1904 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_6_5.jpg http://images.proteinatlas.org/8643/24788_B_6_6.jpg Female 64 2338 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_5_1.jpg http://images.proteinatlas.org/8643/24788_B_5_2.jpg Male 79 2650 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_6_1.jpg http://images.proteinatlas.org/8643/24788_B_6_2.jpg Female 71 3004 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_4_3.jpg http://images.proteinatlas.org/8643/24788_B_4_4.jpg Prostate cancer Tumor cells medium low not detected Male 57 1049 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_9_1.jpg http://images.proteinatlas.org/8643/24786_A_9_2.jpg Male 67 3187 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_9_3.jpg http://images.proteinatlas.org/8643/24786_A_9_4.jpg Male 73 3301 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_7_3.jpg http://images.proteinatlas.org/8643/24786_A_7_4.jpg Male 58 3302 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_7_5.jpg Male 61 3304 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_8_1.jpg http://images.proteinatlas.org/8643/24786_A_8_2.jpg Male 55 3316 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_8_3.jpg http://images.proteinatlas.org/8643/24786_A_8_4.jpg Male 64 3450 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_8_5.jpg http://images.proteinatlas.org/8643/24786_A_8_6.jpg Male 59 3451 Not detected Negative None none http://images.proteinatlas.org/8643/24786_A_9_5.jpg http://images.proteinatlas.org/8643/24786_A_9_6.jpg Male 63 3452 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_9_7.jpg http://images.proteinatlas.org/8643/24786_A_9_8.jpg Male 66 3458 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24786_A_8_7.jpg http://images.proteinatlas.org/8643/24786_A_8_8.jpg Renal cancer Tumor cells high medium low not detected Female 70 1498 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_7_3.jpg http://images.proteinatlas.org/8643/24788_A_7_4.jpg Female 60 1722 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_7_1.jpg http://images.proteinatlas.org/8643/24788_A_7_2.jpg Male 56 1752 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_8_1.jpg http://images.proteinatlas.org/8643/24788_A_8_2.jpg Male 77 1831 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_8_5.jpg http://images.proteinatlas.org/8643/24788_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_9_3.jpg http://images.proteinatlas.org/8643/24788_A_9_4.jpg Male 63 1969 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_9_1.jpg http://images.proteinatlas.org/8643/24788_A_9_2.jpg Female 72 2067 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_7_5.jpg http://images.proteinatlas.org/8643/24788_A_7_6.jpg Male 59 2176 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_7_7.jpg http://images.proteinatlas.org/8643/24788_A_7_8.jpg Male 68 2452 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_8_3.jpg http://images.proteinatlas.org/8643/24788_A_8_4.jpg Male 61 2540 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_9_7.jpg http://images.proteinatlas.org/8643/24788_A_9_8.jpg Female 52 2564 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_8_7.jpg http://images.proteinatlas.org/8643/24788_A_8_8.jpg Female 57 3061 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_9_5.jpg http://images.proteinatlas.org/8643/24788_A_9_6.jpg Skin cancer Tumor cells low not detected Male 24 1693 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_7_2.jpg Female 73 1738 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_8_3.jpg http://images.proteinatlas.org/8643/24787_B_8_4.jpg Female 84 1983 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_8_5.jpg http://images.proteinatlas.org/8643/24787_B_8_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_7_3.jpg http://images.proteinatlas.org/8643/24787_B_7_4.jpg Male 87 2548 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_9_5.jpg http://images.proteinatlas.org/8643/24787_B_9_6.jpg Male 84 3008 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_9_3.jpg http://images.proteinatlas.org/8643/24787_B_9_4.jpg Male 86 3014 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_7_5.jpg http://images.proteinatlas.org/8643/24787_B_7_6.jpg Female 88 3163 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_7_7.jpg http://images.proteinatlas.org/8643/24787_B_7_8.jpg Male 52 3183 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_9_7.jpg Female 44 3261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_B_8_1.jpg http://images.proteinatlas.org/8643/24787_B_8_2.jpg Female 70 3268 Not detected Negative None none http://images.proteinatlas.org/8643/24787_B_9_1.jpg http://images.proteinatlas.org/8643/24787_B_9_2.jpg Stomach cancer Tumor cells medium low not detected Male 77 832 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_3_7.jpg http://images.proteinatlas.org/8643/24788_B_3_8.jpg Female 71 1061 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_3_3.jpg http://images.proteinatlas.org/8643/24788_B_3_4.jpg Female 75 1534 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_2_1.jpg http://images.proteinatlas.org/8643/24788_B_2_2.jpg Male 82 1787 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_1_2.jpg Male 76 2066 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_1_3.jpg http://images.proteinatlas.org/8643/24788_B_1_4.jpg Male 62 2105 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_1_7.jpg http://images.proteinatlas.org/8643/24788_B_1_8.jpg Male 62 2142 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_2_7.jpg http://images.proteinatlas.org/8643/24788_B_2_8.jpg Male 48 2195 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_3_1.jpg http://images.proteinatlas.org/8643/24788_B_3_2.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/8643/24788_B_2_5.jpg Male 59 2378 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_3_5.jpg http://images.proteinatlas.org/8643/24788_B_3_6.jpg Male 59 2473 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_2_3.jpg http://images.proteinatlas.org/8643/24788_B_2_4.jpg Female 73 2557 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_B_1_5.jpg http://images.proteinatlas.org/8643/24788_B_1_6.jpg Testis cancer Tumor cells high medium low not detected Male 52 938 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_3_1.jpg http://images.proteinatlas.org/8643/24788_A_3_2.jpg Male 28 1179 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_3_3.jpg http://images.proteinatlas.org/8643/24788_A_3_4.jpg Male 41 1700 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_3_5.jpg http://images.proteinatlas.org/8643/24788_A_3_6.jpg Male 36 1740 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_1_7.jpg http://images.proteinatlas.org/8643/24788_A_1_8.jpg Male 43 1777 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_2_5.jpg http://images.proteinatlas.org/8643/24788_A_2_6.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_2_3.jpg http://images.proteinatlas.org/8643/24788_A_2_4.jpg Male 59 1900 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_2_1.jpg http://images.proteinatlas.org/8643/24788_A_2_2.jpg Male 26 2071 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_1_3.jpg Male 19 2116 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_1_1.jpg Male 65 2558 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_2_7.jpg http://images.proteinatlas.org/8643/24788_A_2_8.jpg Male 22 2721 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_3_7.jpg http://images.proteinatlas.org/8643/24788_A_3_8.jpg Thyroid cancer Tumor cells low not detected Male 77 2623 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_3_5.jpg http://images.proteinatlas.org/8643/24787_A_3_6.jpg Male 75 3107 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_3_3.jpg http://images.proteinatlas.org/8643/24787_A_3_4.jpg Female 30 3131 Not detected Negative None none http://images.proteinatlas.org/8643/24787_A_3_7.jpg Male 33 3267 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24787_A_3_1.jpg http://images.proteinatlas.org/8643/24787_A_3_2.jpg Urothelial cancer Tumor cells medium low not detected Female 60 1723 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_5_8.jpg Male 78 1774 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_4_3.jpg http://images.proteinatlas.org/8643/24788_A_4_4.jpg Male 66 1824 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_5_1.jpg http://images.proteinatlas.org/8643/24788_A_5_2.jpg Female 85 1871 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_6_1.jpg http://images.proteinatlas.org/8643/24788_A_6_2.jpg Male 61 1984 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_5_5.jpg http://images.proteinatlas.org/8643/24788_A_5_6.jpg Female 80 2031 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_5_3.jpg Male 51 2053 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_6_7.jpg http://images.proteinatlas.org/8643/24788_A_6_8.jpg Male 60 2098 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_4_5.jpg http://images.proteinatlas.org/8643/24788_A_4_6.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_4_8.jpg Female 64 3002 Not detected Negative None none http://images.proteinatlas.org/8643/24788_A_6_6.jpg Female 56 3077 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_6_3.jpg http://images.proteinatlas.org/8643/24788_A_6_4.jpg Female 79 3265 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/8643/24788_A_4_1.jpg http://images.proteinatlas.org/8643/24788_A_4_2.jpg IGHV1-18 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi HL-60 RPMI-8226 TIME Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV1-2 V35 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter U-266/70 Detected in some U-266 - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV1-3 VI-3B Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Karpas-707 Detected in some Karpas-707 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV1-46 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter BEWO RPMI-8226 SH-SY5Y TIME U-266/70 U-266/84 Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 Not detected B-cells - Unknown function Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC Not detected Plasma cells Detected in some Plasma cells - Humoral immune response IGHV1-69 IGHV1-E Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue urinary bladder Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta medulla oblongata pons Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter HEL HMC-1 MOLT-4 SCLC-21H U-698 Detected in some JURKAT & MOLT-4 - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell plasmacytoid DC Detected in some Neutrophils - Inflammatory response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV1-69D Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue stomach 1 Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi HL-60 MOLT-4 RPMI-8226 U-266/70 U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells T-cells Detected in some Alveolar cells - Smell perception IGHV2-5 Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Karpas-707 Detected in some Karpas-707 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV3-11 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi SH-SY5Y Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV3-15 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland stomach 1 urinary bladder Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter BEWO Daudi HL-60 K-562 NB-4 RH-30 RPMI-8226 SH-SY5Y Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 MAIT T-cell memory B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells T-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV3-21 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi NB-4 NTERA-2 RH-30 TIME Detected in some TIME & HUVEC/TERT2 - Endothelial cell function A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 Not detected Plasmacytoid DCs - Protein folding Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC Not detected Plasma cells Detected in some Plasma cells - Humoral immune response IGHV3-30 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter BEWO Daudi NB-4 RPMI-8226 SCLC-21H SH-SY5Y U-266/70 Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV3-43 Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 SH-SY5Y Detected in some SH-SY5Y - Nervous system development A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Unknown function Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV3-49 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 Detected in single NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV3-53 Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV4-28 Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta spinal cord Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV4-31 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue urinary bladder Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta spinal cord Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 SH-SY5Y Detected in some RPMI-8226 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV4-34 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue urinary bladder Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 neutrophil Detected in single Neutrophils - Inflammatory response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGHV4-39 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland urinary bladder Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter BEWO Daudi HL-60 NB-4 RH-30 RPMI-8226 U-266/70 U-698 Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV4-4 Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Head and neck cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta midbrain Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Karpas-707 Detected in some Karpas-707 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV4-59 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta spinal cord Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter MOLT-4 SCLC-21H SH-SY5Y Detected in some JURKAT & MOLT-4 - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGHV5-51 Secreted

approved Liver http://images.proteinatlas.org/6014/44684_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/6014/44684_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/6014/44684_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/6014/44684_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/6014/44684_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/6014/44684_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland urinary bladder Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter BEWO Daudi K-562 NB-4 TIME Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 Not detected Basophils - Cellular respiration Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC Not detected Plasma cells Detected in some Plasma cells - Humoral immune response EVQLLQSAAEVKRPGESLRISCKTSGYSFTSYWIHWVRQMPGKELEWMGSIYPGNSDTRYSPSFQGHVTISADSSSSTAYLQWSSLKASDAAMYYCVRG

approved No tissue staining or RNA expression data available for comparison Not done http://images.proteinatlas.org/6014/ihc_selected.jpg Adipose tissue Adipocytes not detected weak <25% cytoplasmic/membranous Male 14 1990 http://images.proteinatlas.org/6014/44684_B_2_8.jpg Female 75 2042 http://images.proteinatlas.org/6014/44684_B_1_7.jpg Female 75 2094 http://images.proteinatlas.org/6014/44684_B_3_8.jpg Female 35 2587 http://images.proteinatlas.org/6014/44684_B_2_7.jpg Female 73 3144 http://images.proteinatlas.org/6014/44684_B_1_8.jpg Female 60 3548 http://images.proteinatlas.org/6014/44684_B_3_7.jpg Adrenal gland Glandular cells not detected negative none none Female 47 2741 http://images.proteinatlas.org/6014/44684_B_5_5.jpg Female 59 3238 http://images.proteinatlas.org/6014/44684_B_4_5.jpg Male 56 3444 http://images.proteinatlas.org/6014/44684_B_6_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue medium strong <25% cytoplasmic/membranous Male 56 1993 http://images.proteinatlas.org/6014/44684_A_3_2.jpg Female 20 2444 http://images.proteinatlas.org/6014/44684_A_1_2.jpg Male 1 3538 http://images.proteinatlas.org/6014/44684_A_2_2.jpg Bone marrow Hematopoietic cells low moderate <25% cytoplasmic/membranous Female 67 3650 http://images.proteinatlas.org/6014/44684_B_6_4.jpg Female 53 3663 http://images.proteinatlas.org/6014/44684_B_4_4.jpg Breast Adipocytes not detected negative none none Glandular cells medium moderate 75%-25% cytoplasmic/membranous Myoepithelial cells low weak >75% cytoplasmic/membranous Female 22 2330 http://images.proteinatlas.org/6014/44684_B_3_4.jpg Female 45 3544 http://images.proteinatlas.org/6014/44684_B_2_4.jpg Bronchus Respiratory epithelial cells low moderate <25% cytoplasmic/membranous Female 63 1765 http://images.proteinatlas.org/6014/44684_B_5_2.jpg Male 77 3404 http://images.proteinatlas.org/6014/44684_B_6_2.jpg Female 53 3482 http://images.proteinatlas.org/6014/44684_B_4_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/6014/44684_B_9_7.jpg Female 19 2524 http://images.proteinatlas.org/6014/44684_B_7_7.jpg Male 45 3622 http://images.proteinatlas.org/6014/44684_B_8_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/6014/44684_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/6014/44684_B_9_8.jpg Female 19 2524 http://images.proteinatlas.org/6014/44684_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Neuropil not detected negative none none Female 30 1582 http://images.proteinatlas.org/6014/44684_B_8_5.jpg Male 45 2521 http://images.proteinatlas.org/6014/44684_B_7_5.jpg Female 19 2524 http://images.proteinatlas.org/6014/44684_B_9_5.jpg Cervix Glandular cells medium moderate 75%-25% cytoplasmic/membranous Squamous epithelial cells not detected negative none none Female 77 1896 http://images.proteinatlas.org/6014/44684_B_7_3.jpg Female 55 2005 http://images.proteinatlas.org/6014/44684_B_8_3.jpg Female 72 2535 http://images.proteinatlas.org/6014/44684_B_9_3.jpg Colon Endothelial cells not detected negative none none Glandular cells medium moderate 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 56 1423 http://images.proteinatlas.org/6014/44684_A_7_3.jpg Female 80 2944 http://images.proteinatlas.org/6014/44684_A_9_3.jpg Male 73 3266 http://images.proteinatlas.org/6014/44684_A_8_3.jpg Duodenum Glandular cells not detected negative none none Male 50 1904 http://images.proteinatlas.org/6014/44684_A_7_2.jpg Male 54 2562 http://images.proteinatlas.org/6014/44684_A_9_2.jpg Female 71 3004 http://images.proteinatlas.org/6014/44684_A_8_2.jpg Endometrium 1 Cells in endometrial stroma low moderate <25% cytoplasmic/membranous Glandular cells not detected negative none none Female 42 2242 http://images.proteinatlas.org/6014/44684_B_5_3.jpg Female 33 2941 http://images.proteinatlas.org/6014/44684_B_6_3.jpg Female 39 3313 http://images.proteinatlas.org/6014/44684_B_4_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 41 1792 http://images.proteinatlas.org/6014/44684_B_1_3.jpg Female 66 3352 http://images.proteinatlas.org/6014/44684_B_2_3.jpg Female 51 3491 http://images.proteinatlas.org/6014/44684_B_3_3.jpg Epididymis Glandular cells low weak 75%-25% cytoplasmic/membranous Male 36 1740 http://images.proteinatlas.org/6014/44684_A_3_6.jpg Male 56 3355 http://images.proteinatlas.org/6014/44684_A_1_6.jpg Male 34 3613 http://images.proteinatlas.org/6014/44684_A_2_6.jpg Esophagus Squamous epithelial cells not detected negative none none Female 61 1924 http://images.proteinatlas.org/6014/44684_B_4_1.jpg Male 48 3044 http://images.proteinatlas.org/6014/44684_B_6_1.jpg Male 54 3197 http://images.proteinatlas.org/6014/44684_B_5_1.jpg Fallopian tube Glandular cells low weak 75%-25% cytoplasmic/membranous Female 23 2138 http://images.proteinatlas.org/6014/44684_A_7_7.jpg Female 34 2382 http://images.proteinatlas.org/6014/44684_A_8_7.jpg Female 32 2447 http://images.proteinatlas.org/6014/44684_A_9_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 49 1913 http://images.proteinatlas.org/6014/44684_A_6_4.jpg Female 64 2025 http://images.proteinatlas.org/6014/44684_A_5_4.jpg Female 26 2446 http://images.proteinatlas.org/6014/44684_A_4_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 45 2521 http://images.proteinatlas.org/6014/44684_B_4_6.jpg Female 54 2523 http://images.proteinatlas.org/6014/44684_B_5_6.jpg Female 19 2524 http://images.proteinatlas.org/6014/44684_B_6_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Female 54 2523 http://images.proteinatlas.org/6014/44684_B_8_6.jpg Male 45 3622 http://images.proteinatlas.org/6014/44684_B_7_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 16 1767 http://images.proteinatlas.org/6014/44684_A_8_5.jpg Female 56 1933 http://images.proteinatlas.org/6014/44684_A_9_5.jpg Male 59 3229 http://images.proteinatlas.org/6014/44684_A_7_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 55 2429 http://images.proteinatlas.org/6014/44684_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/6014/44684_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/6014/44684_A_7_4.jpg Lung Alveolar cells not detected negative none none Macrophages medium moderate >75% cytoplasmic/membranous Male 21 2101 http://images.proteinatlas.org/6014/44684_A_1_4.jpg Male 59 2222 http://images.proteinatlas.org/6014/44684_A_3_4.jpg Female 49 2268 http://images.proteinatlas.org/6014/44684_A_2_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Male 55 1724 http://images.proteinatlas.org/6014/44684_A_7_8.jpg Female 53 3285 http://images.proteinatlas.org/6014/44684_A_9_8.jpg Nasopharynx Respiratory epithelial cells not detected weak <25% cytoplasmic/membranous Male 48 2402 http://images.proteinatlas.org/6014/44684_B_8_2.jpg Male 21 2688 http://images.proteinatlas.org/6014/44684_B_9_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 71 1711 http://images.proteinatlas.org/6014/44684_A_9_1.jpg Male 66 2547 http://images.proteinatlas.org/6014/44684_A_7_1.jpg Ovary Ovarian stroma cells low weak 75%-25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/6014/44684_A_5_7.jpg Female 33 2159 http://images.proteinatlas.org/6014/44684_A_4_7.jpg Female 41 2713 http://images.proteinatlas.org/6014/44684_A_6_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/6014/44684_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/6014/44684_A_1_3.jpg Female 70 3320 http://images.proteinatlas.org/6014/44684_A_2_3.jpg Parathyroid gland Glandular cells not detected weak <25% cytoplasmic/membranous Female 64 3509 http://images.proteinatlas.org/6014/44684_A_3_8.jpg Female 58 3629 http://images.proteinatlas.org/6014/44684_A_1_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected negative none none Female 18 2390 http://images.proteinatlas.org/6014/44684_A_2_7.jpg Female 30 2515 http://images.proteinatlas.org/6014/44684_A_1_7.jpg Female 30 2903 http://images.proteinatlas.org/6014/44684_A_3_7.jpg Prostate Glandular cells not detected negative none none Male 51 2053 http://images.proteinatlas.org/6014/44684_A_3_5.jpg Male 60 2098 http://images.proteinatlas.org/6014/44684_A_2_5.jpg Male 76 2932 http://images.proteinatlas.org/6014/44684_A_1_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Male 64 2953 http://images.proteinatlas.org/6014/44684_A_6_3.jpg Male 44 3231 http://images.proteinatlas.org/6014/44684_A_4_3.jpg Female 65 3243 http://images.proteinatlas.org/6014/44684_A_5_3.jpg Salivary gland Glandular cells not detected negative none none Male 63 1845 http://images.proteinatlas.org/6014/44684_B_1_1.jpg Female 33 2048 http://images.proteinatlas.org/6014/44684_B_3_1.jpg Male 62 2367 http://images.proteinatlas.org/6014/44684_B_2_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 68 3297 http://images.proteinatlas.org/6014/44684_A_8_6.jpg Male 55 3316 http://images.proteinatlas.org/6014/44684_A_9_6.jpg Skeletal muscle Myocytes not detected negative none none Male 62 1505 http://images.proteinatlas.org/6014/44684_B_3_6.jpg Male 83 2360 http://images.proteinatlas.org/6014/44684_B_2_6.jpg Female 84 2406 http://images.proteinatlas.org/6014/44684_B_1_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected negative none none Langerhans not detected negative none none Melanocytes not detected negative none none Male 40 2334 http://images.proteinatlas.org/6014/44684_B_9_1.jpg Female 17 3532 http://images.proteinatlas.org/6014/44684_B_8_1.jpg Skin 2 Epidermal cells not detected weak <25% cytoplasmic/membranous Male 44 3231 http://images.proteinatlas.org/6014/44684_B_6_8.jpg Female 73 3318 http://images.proteinatlas.org/6014/44684_B_5_8.jpg Female 66 3357 http://images.proteinatlas.org/6014/44684_B_4_8.jpg Small intestine Glandular cells not detected negative none none Female 84 2256 http://images.proteinatlas.org/6014/44684_A_5_2.jpg Female 51 2467 http://images.proteinatlas.org/6014/44684_A_4_2.jpg Female 56 3343 http://images.proteinatlas.org/6014/44684_A_6_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 33 2175 http://images.proteinatlas.org/6014/44684_B_4_7.jpg Male 67 2404 http://images.proteinatlas.org/6014/44684_B_5_7.jpg Soft tissue 1 Chondrocytes not detected negative none none Fibroblasts not detected negative none none Peripheral nerve not detected weak <25% cytoplasmic/membranous Male 14 1990 http://images.proteinatlas.org/6014/44684_B_2_8.jpg Female 75 2094 http://images.proteinatlas.org/6014/44684_B_3_8.jpg Female 73 3144 http://images.proteinatlas.org/6014/44684_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Female 75 2042 http://images.proteinatlas.org/6014/44684_B_1_7.jpg Female 35 2587 http://images.proteinatlas.org/6014/44684_B_2_7.jpg Female 60 3548 http://images.proteinatlas.org/6014/44684_B_3_7.jpg Spleen Cells in red pulp medium strong <25% cytoplasmic/membranous Cells in white pulp not detected negative none none Male 72 1714 http://images.proteinatlas.org/6014/44684_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/6014/44684_B_9_4.jpg Male 36 2940 http://images.proteinatlas.org/6014/44684_B_8_4.jpg Stomach 1 Glandular cells not detected negative none none Female 56 2130 http://images.proteinatlas.org/6014/44684_A_5_1.jpg Male 72 2583 http://images.proteinatlas.org/6014/44684_A_4_1.jpg Male 39 3368 http://images.proteinatlas.org/6014/44684_A_6_1.jpg Stomach 2 Glandular cells low moderate <25% cytoplasmic/membranous Female 75 1534 http://images.proteinatlas.org/6014/44684_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/6014/44684_A_1_1.jpg Female 56 3233 http://images.proteinatlas.org/6014/44684_A_3_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells medium moderate >75% cytoplasmic/membranous Male 26 2254 http://images.proteinatlas.org/6014/44684_A_5_6.jpg Male 46 2435 http://images.proteinatlas.org/6014/44684_A_6_6.jpg Male 56 3355 http://images.proteinatlas.org/6014/44684_A_4_6.jpg Thyroid gland Glandular cells not detected negative none none Male 56 1672 http://images.proteinatlas.org/6014/44684_B_2_5.jpg Female 44 3005 http://images.proteinatlas.org/6014/44684_B_3_5.jpg Female 28 3536 http://images.proteinatlas.org/6014/44684_B_1_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 37 2512 http://images.proteinatlas.org/6014/44684_A_6_8.jpg Male 17 2615 http://images.proteinatlas.org/6014/44684_A_5_8.jpg Female 19 3294 http://images.proteinatlas.org/6014/44684_A_4_8.jpg Urinary bladder Urothelial cells low moderate <25% cytoplasmic/membranous Male 46 3184 http://images.proteinatlas.org/6014/44684_A_5_5.jpg Male 37 3497 http://images.proteinatlas.org/6014/44684_A_4_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 44 2480 http://images.proteinatlas.org/6014/44684_B_2_2.jpg Female 32 2841 http://images.proteinatlas.org/6014/44684_B_3_2.jpg

Breast cancer Tumor cells medium low not detected Female 80 1874 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_6_1.jpg http://images.proteinatlas.org/6014/44653_A_6_2.jpg Female 46 1882 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_4_3.jpg http://images.proteinatlas.org/6014/44653_A_4_4.jpg Female 61 1910 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_6_7.jpg http://images.proteinatlas.org/6014/44653_A_6_8.jpg Female 87 1939 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_6_5.jpg http://images.proteinatlas.org/6014/44653_A_6_6.jpg Female 51 2083 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_4_5.jpg http://images.proteinatlas.org/6014/44653_A_4_6.jpg Female 40 2091 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_4_7.jpg http://images.proteinatlas.org/6014/44653_A_4_8.jpg Female 37 2174 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_5_7.jpg http://images.proteinatlas.org/6014/44653_A_5_8.jpg Female 27 2392 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_6_3.jpg http://images.proteinatlas.org/6014/44653_A_6_4.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_5_3.jpg http://images.proteinatlas.org/6014/44653_A_5_4.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_5_1.jpg http://images.proteinatlas.org/6014/44653_A_5_2.jpg Female 41 2898 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_4_2.jpg Female 39 3257 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_5_5.jpg http://images.proteinatlas.org/6014/44653_A_5_6.jpg Carcinoid Tumor cells low not detected Male 41 2618 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_1_7.jpg http://images.proteinatlas.org/6014/44654_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_1_3.jpg http://images.proteinatlas.org/6014/44654_A_1_4.jpg Male 30 3171 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_1_1.jpg http://images.proteinatlas.org/6014/44654_A_1_2.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_1_5.jpg http://images.proteinatlas.org/6014/44654_A_1_6.jpg Cervical cancer Tumor cells medium not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_6_1.jpg http://images.proteinatlas.org/6014/44653_B_6_2.jpg Female 57 642 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_4_3.jpg http://images.proteinatlas.org/6014/44653_B_4_4.jpg Female 36 1733 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_6_7.jpg http://images.proteinatlas.org/6014/44653_B_6_8.jpg Female 34 1751 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_5_1.jpg http://images.proteinatlas.org/6014/44653_B_5_2.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_4_5.jpg http://images.proteinatlas.org/6014/44653_B_4_6.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_5_5.jpg http://images.proteinatlas.org/6014/44653_B_5_6.jpg Female 32 2841 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_4_1.jpg http://images.proteinatlas.org/6014/44653_B_4_2.jpg Female 35 3333 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_4_7.jpg http://images.proteinatlas.org/6014/44653_B_4_8.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_6_5.jpg http://images.proteinatlas.org/6014/44653_B_6_6.jpg Female 46 3400 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_5_7.jpg http://images.proteinatlas.org/6014/44653_B_5_8.jpg Female 63 3409 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_5_3.jpg http://images.proteinatlas.org/6014/44653_B_5_4.jpg Female 39 3500 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_6_3.jpg http://images.proteinatlas.org/6014/44653_B_6_4.jpg Colorectal cancer Tumor cells low not detected Male 71 1898 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_2_3.jpg http://images.proteinatlas.org/6014/44653_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_1_5.jpg http://images.proteinatlas.org/6014/44653_A_1_6.jpg Male 92 2001 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_2_1.jpg Male 72 2096 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_3_3.jpg http://images.proteinatlas.org/6014/44653_A_3_4.jpg Female 75 2151 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_3_5.jpg http://images.proteinatlas.org/6014/44653_A_3_6.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_2_7.jpg http://images.proteinatlas.org/6014/44653_A_2_8.jpg Male 84 2707 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_1_7.jpg http://images.proteinatlas.org/6014/44653_A_1_8.jpg Male 87 2735 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_1_1.jpg Female 66 2948 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_2_5.jpg Male 56 2957 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_1_3.jpg http://images.proteinatlas.org/6014/44653_A_1_4.jpg Female 89 3274 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_3_1.jpg Endometrial cancer Tumor cells medium low not detected Female 53 1766 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_8_7.jpg http://images.proteinatlas.org/6014/44653_B_8_8.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_9_1.jpg http://images.proteinatlas.org/6014/44653_B_9_2.jpg Female 70 2118 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_7_1.jpg http://images.proteinatlas.org/6014/44653_B_7_2.jpg Female 79 2339 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_9_3.jpg http://images.proteinatlas.org/6014/44653_B_9_4.jpg Female 58 2455 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_8_1.jpg http://images.proteinatlas.org/6014/44653_B_8_2.jpg Female 81 2607 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_8_5.jpg http://images.proteinatlas.org/6014/44653_B_8_6.jpg Female 58 2621 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_7_7.jpg http://images.proteinatlas.org/6014/44653_B_7_8.jpg Female 63 2772 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_7_3.jpg http://images.proteinatlas.org/6014/44653_B_7_4.jpg Female 32 3036 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_9_5.jpg http://images.proteinatlas.org/6014/44653_B_9_6.jpg Female 85 3319 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_7_5.jpg http://images.proteinatlas.org/6014/44653_B_7_6.jpg Female 51 3481 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_8_3.jpg http://images.proteinatlas.org/6014/44653_B_8_4.jpg Female 80 3540 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_9_7.jpg http://images.proteinatlas.org/6014/44653_B_9_8.jpg Glioma Tumor cells medium low not detected Male 77 1537 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_5_7.jpg http://images.proteinatlas.org/6014/44654_A_5_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_4_1.jpg http://images.proteinatlas.org/6014/44654_A_4_2.jpg Male 33 1627 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_6_3.jpg http://images.proteinatlas.org/6014/44654_A_6_4.jpg Female 59 1645 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_6_5.jpg http://images.proteinatlas.org/6014/44654_A_6_6.jpg Male 72 2527 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_5_5.jpg http://images.proteinatlas.org/6014/44654_A_5_6.jpg Female 37 2529 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_5_3.jpg http://images.proteinatlas.org/6014/44654_A_5_4.jpg Male 71 3091 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_6_7.jpg http://images.proteinatlas.org/6014/44654_A_6_8.jpg Male 38 3120 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_4_3.jpg http://images.proteinatlas.org/6014/44654_A_4_4.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_5_1.jpg http://images.proteinatlas.org/6014/44654_A_5_2.jpg Female 58 3241 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_4_7.jpg http://images.proteinatlas.org/6014/44654_A_4_8.jpg Male 34 3326 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_6_1.jpg http://images.proteinatlas.org/6014/44654_A_6_2.jpg Male 65 3365 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_4_5.jpg http://images.proteinatlas.org/6014/44654_A_4_6.jpg Head and neck cancer Tumor cells medium not detected Male 62 1743 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_2_3.jpg http://images.proteinatlas.org/6014/44654_A_2_4.jpg Male 66 2547 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_2_5.jpg http://images.proteinatlas.org/6014/44654_A_2_6.jpg Male 51 2608 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_2_1.jpg Female 76 3621 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_2_7.jpg http://images.proteinatlas.org/6014/44654_A_2_8.jpg Liver cancer Tumor cells low not detected Female 58 2177 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_8_1.jpg http://images.proteinatlas.org/6014/44683_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_7_1.jpg http://images.proteinatlas.org/6014/44683_B_7_2.jpg Male 80 2280 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_9_1.jpg http://images.proteinatlas.org/6014/44683_B_9_2.jpg Female 52 2399 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_8_7.jpg Male 72 2556 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_9_3.jpg http://images.proteinatlas.org/6014/44683_B_9_4.jpg Male 50 2578 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_8_3.jpg http://images.proteinatlas.org/6014/44683_B_8_4.jpg Female 73 2766 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_7_7.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_8_5.jpg http://images.proteinatlas.org/6014/44683_B_8_6.jpg Female 61 3215 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_7_3.jpg http://images.proteinatlas.org/6014/44683_B_7_4.jpg Female 73 3346 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_9_5.jpg http://images.proteinatlas.org/6014/44683_B_9_6.jpg Male 67 3477 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_9_7.jpg Male 59 3625 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_7_5.jpg http://images.proteinatlas.org/6014/44683_B_7_6.jpg Lung cancer Tumor cells medium low not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_1_7.jpg http://images.proteinatlas.org/6014/44654_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/6014/44654_B_3_5.jpg http://images.proteinatlas.org/6014/44654_B_3_6.jpg Male 59 2222 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_3_7.jpg http://images.proteinatlas.org/6014/44654_B_3_8.jpg Male 71 2231 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_2_7.jpg http://images.proteinatlas.org/6014/44654_B_2_8.jpg Female 49 2268 Low Weak >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/6014/44654_B_2_3.jpg http://images.proteinatlas.org/6014/44654_B_2_4.jpg Male 61 2354 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_2_6.jpg Male 49 3003 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_2_1.jpg http://images.proteinatlas.org/6014/44654_B_2_2.jpg Female 73 3016 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_1_3.jpg http://images.proteinatlas.org/6014/44654_B_1_4.jpg Female 51 3052 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_3_1.jpg http://images.proteinatlas.org/6014/44654_B_3_2.jpg Female 70 3391 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_1_1.jpg http://images.proteinatlas.org/6014/44654_B_1_2.jpg Lymphoma Tumor cells medium not detected Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_7_7.jpg http://images.proteinatlas.org/6014/44654_A_7_8.jpg Female 36 1606 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_7_5.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_7_1.jpg http://images.proteinatlas.org/6014/44654_A_7_2.jpg Female 19 1734 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_8_7.jpg http://images.proteinatlas.org/6014/44654_A_8_8.jpg Male 18 2604 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_9_7.jpg http://images.proteinatlas.org/6014/44654_A_9_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_9_1.jpg http://images.proteinatlas.org/6014/44654_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_9_6.jpg Male 83 2883 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_8_1.jpg http://images.proteinatlas.org/6014/44654_A_8_2.jpg Female 76 3010 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_8_6.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_8_3.jpg http://images.proteinatlas.org/6014/44654_A_8_4.jpg Male 61 3085 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_7_3.jpg http://images.proteinatlas.org/6014/44654_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_9_3.jpg http://images.proteinatlas.org/6014/44654_A_9_4.jpg Melanoma Tumor cells medium low not detected Female 58 836 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_5_1.jpg http://images.proteinatlas.org/6014/44654_B_5_2.jpg Male 59 1414 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_6_6.jpg Male 61 1482 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_6_7.jpg http://images.proteinatlas.org/6014/44654_B_6_8.jpg Male 41 2112 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_5_7.jpg http://images.proteinatlas.org/6014/44654_B_5_8.jpg Female 87 2136 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_4_5.jpg http://images.proteinatlas.org/6014/44654_B_4_6.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_4_1.jpg http://images.proteinatlas.org/6014/44654_B_4_2.jpg Female 30 2598 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_5_5.jpg http://images.proteinatlas.org/6014/44654_B_5_6.jpg Female 73 2900 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_4_7.jpg http://images.proteinatlas.org/6014/44654_B_4_8.jpg Female 82 3060 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_6_1.jpg http://images.proteinatlas.org/6014/44654_B_6_2.jpg Male 59 3351 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_4_3.jpg http://images.proteinatlas.org/6014/44654_B_4_4.jpg Male 62 3610 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_6_3.jpg Female 72 3611 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_5_3.jpg http://images.proteinatlas.org/6014/44654_B_5_4.jpg Ovarian cancer Tumor cells medium low not detected Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_3_5.jpg http://images.proteinatlas.org/6014/44653_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_2_1.jpg http://images.proteinatlas.org/6014/44653_B_2_2.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_1_1.jpg http://images.proteinatlas.org/6014/44653_B_1_2.jpg Female 69 2391 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_3_7.jpg http://images.proteinatlas.org/6014/44653_B_3_8.jpg Female 62 2568 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_1_3.jpg http://images.proteinatlas.org/6014/44653_B_1_4.jpg Female 80 2747 Not detected Negative None none http://images.proteinatlas.org/6014/44653_B_3_3.jpg http://images.proteinatlas.org/6014/44653_B_3_4.jpg Female 79 2889 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_1_5.jpg http://images.proteinatlas.org/6014/44653_B_1_6.jpg Female 56 3115 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_3_1.jpg http://images.proteinatlas.org/6014/44653_B_3_2.jpg Female 44 3146 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_1_7.jpg Female 61 3323 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_B_2_5.jpg http://images.proteinatlas.org/6014/44653_B_2_6.jpg Pancreatic cancer Tumor cells medium low not detected Female 70 823 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_6_7.jpg http://images.proteinatlas.org/6014/44683_B_6_8.jpg Male 50 1904 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_6_5.jpg http://images.proteinatlas.org/6014/44683_B_6_6.jpg Female 71 3004 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_4_3.jpg http://images.proteinatlas.org/6014/44683_B_4_4.jpg Female 56 3233 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_4_5.jpg http://images.proteinatlas.org/6014/44683_B_4_6.jpg Female 78 3363 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_5_5.jpg http://images.proteinatlas.org/6014/44683_B_5_6.jpg Female 60 3548 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_5_2.jpg Female 70 3591 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_5_7.jpg Male 69 3594 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_6_1.jpg http://images.proteinatlas.org/6014/44683_B_6_2.jpg Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_6_3.jpg http://images.proteinatlas.org/6014/44683_B_6_4.jpg Female 73 3719 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_4_1.jpg http://images.proteinatlas.org/6014/44683_B_4_2.jpg Prostate cancer Tumor cells not detected Male 89 2828 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_7_5.jpg http://images.proteinatlas.org/6014/44653_A_7_6.jpg Male 61 3486 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_8_7.jpg http://images.proteinatlas.org/6014/44653_A_8_8.jpg Male 65 3555 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_9_5.jpg http://images.proteinatlas.org/6014/44653_A_9_6.jpg Male 50 3559 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_7_1.jpg http://images.proteinatlas.org/6014/44653_A_7_2.jpg Male 71 3571 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_7_3.jpg http://images.proteinatlas.org/6014/44653_A_7_4.jpg Male 71 3574 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_8_3.jpg http://images.proteinatlas.org/6014/44653_A_8_4.jpg Male 60 3577 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_9_3.jpg http://images.proteinatlas.org/6014/44653_A_9_4.jpg Male 52 3578 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_8_1.jpg http://images.proteinatlas.org/6014/44653_A_8_2.jpg Male 61 3579 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_9_7.jpg http://images.proteinatlas.org/6014/44653_A_9_8.jpg Male 69 3580 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_8_5.jpg http://images.proteinatlas.org/6014/44653_A_8_6.jpg Male 63 3583 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44653_A_7_7.jpg http://images.proteinatlas.org/6014/44653_A_7_8.jpg Male 70 3584 Not detected Negative None none http://images.proteinatlas.org/6014/44653_A_9_2.jpg Renal cancer Tumor cells medium low not detected Female 70 1498 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_7_3.jpg http://images.proteinatlas.org/6014/44683_A_7_4.jpg Male 56 1752 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_8_1.jpg http://images.proteinatlas.org/6014/44683_A_8_2.jpg Male 77 1831 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_8_5.jpg http://images.proteinatlas.org/6014/44683_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_9_3.jpg http://images.proteinatlas.org/6014/44683_A_9_4.jpg Male 63 1969 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_9_1.jpg http://images.proteinatlas.org/6014/44683_A_9_2.jpg Female 72 2067 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_7_5.jpg http://images.proteinatlas.org/6014/44683_A_7_6.jpg Male 59 2176 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_7_7.jpg http://images.proteinatlas.org/6014/44683_A_7_8.jpg Male 68 2452 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_8_3.jpg http://images.proteinatlas.org/6014/44683_A_8_4.jpg Female 52 2564 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_8_7.jpg http://images.proteinatlas.org/6014/44683_A_8_8.jpg Female 57 3061 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_9_5.jpg http://images.proteinatlas.org/6014/44683_A_9_6.jpg Male 77 3225 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_9_7.jpg http://images.proteinatlas.org/6014/44683_A_9_8.jpg Female 54 3533 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_7_1.jpg http://images.proteinatlas.org/6014/44683_A_7_2.jpg Skin cancer Tumor cells low not detected Male 75 2111 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_7_3.jpg http://images.proteinatlas.org/6014/44654_B_7_4.jpg Male 74 2171 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_9_6.jpg Male 93 2809 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_7_1.jpg http://images.proteinatlas.org/6014/44654_B_7_2.jpg Male 86 3014 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_7_5.jpg http://images.proteinatlas.org/6014/44654_B_7_6.jpg Female 80 3031 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_8_3.jpg http://images.proteinatlas.org/6014/44654_B_8_4.jpg Female 88 3163 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_7_8.jpg Female 44 3261 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_8_1.jpg http://images.proteinatlas.org/6014/44654_B_8_2.jpg Male 85 3328 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_9_1.jpg Male 79 3381 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_B_9_3.jpg http://images.proteinatlas.org/6014/44654_B_9_4.jpg Female 59 3520 Not detected Negative None none http://images.proteinatlas.org/6014/44654_B_8_7.jpg http://images.proteinatlas.org/6014/44654_B_8_8.jpg Stomach cancer Tumor cells medium low not detected Male 69 464 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_2_1.jpg http://images.proteinatlas.org/6014/44683_B_2_2.jpg Male 82 1787 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_1_1.jpg http://images.proteinatlas.org/6014/44683_B_1_2.jpg Male 76 2066 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_1_3.jpg http://images.proteinatlas.org/6014/44683_B_1_4.jpg Male 62 2105 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_1_7.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_2_7.jpg Male 48 2195 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_3_1.jpg http://images.proteinatlas.org/6014/44683_B_3_2.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_3_5.jpg http://images.proteinatlas.org/6014/44683_B_3_6.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_2_3.jpg http://images.proteinatlas.org/6014/44683_B_2_4.jpg Female 73 2557 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_1_5.jpg Female 59 2959 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_B_3_7.jpg Female 89 3270 Not detected Negative None none http://images.proteinatlas.org/6014/44683_B_3_3.jpg http://images.proteinatlas.org/6014/44683_B_3_4.jpg Testis cancer Tumor cells high medium low not detected Male 32 488 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_3_3.jpg http://images.proteinatlas.org/6014/44683_A_3_4.jpg Male 2 1082 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_1_5.jpg http://images.proteinatlas.org/6014/44683_A_1_6.jpg Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_3_5.jpg http://images.proteinatlas.org/6014/44683_A_3_6.jpg Male 36 1740 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_1_7.jpg http://images.proteinatlas.org/6014/44683_A_1_8.jpg Male 43 1777 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_2_5.jpg http://images.proteinatlas.org/6014/44683_A_2_6.jpg Male 71 1818 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_2_3.jpg Male 26 2071 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_1_3.jpg http://images.proteinatlas.org/6014/44683_A_1_4.jpg Male 65 2558 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_2_7.jpg http://images.proteinatlas.org/6014/44683_A_2_8.jpg Male 22 2721 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_3_7.jpg http://images.proteinatlas.org/6014/44683_A_3_8.jpg Male 25 3627 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_1_1.jpg http://images.proteinatlas.org/6014/44683_A_1_2.jpg Thyroid cancer Tumor cells low not detected Male 77 2623 Not detected Negative None none http://images.proteinatlas.org/6014/44654_A_3_5.jpg http://images.proteinatlas.org/6014/44654_A_3_6.jpg Male 75 3107 Not detected Weak <25% nuclear http://images.proteinatlas.org/6014/44654_A_3_3.jpg http://images.proteinatlas.org/6014/44654_A_3_4.jpg Male 33 3267 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_3_1.jpg http://images.proteinatlas.org/6014/44654_A_3_2.jpg Female 42 3490 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44654_A_3_7.jpg http://images.proteinatlas.org/6014/44654_A_3_8.jpg Urothelial cancer Tumor cells medium low not detected Male 78 1774 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_4_3.jpg http://images.proteinatlas.org/6014/44683_A_4_4.jpg Female 85 1871 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_6_1.jpg http://images.proteinatlas.org/6014/44683_A_6_2.jpg Female 80 2031 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_5_3.jpg http://images.proteinatlas.org/6014/44683_A_5_4.jpg Male 51 2053 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_6_7.jpg http://images.proteinatlas.org/6014/44683_A_6_8.jpg Male 35 2311 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_5_7.jpg http://images.proteinatlas.org/6014/44683_A_5_8.jpg Male 78 2469 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_4_7.jpg http://images.proteinatlas.org/6014/44683_A_4_8.jpg Male 77 2802 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_5_5.jpg http://images.proteinatlas.org/6014/44683_A_5_6.jpg Female 56 3077 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_6_3.jpg http://images.proteinatlas.org/6014/44683_A_6_4.jpg Female 82 3112 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_5_1.jpg http://images.proteinatlas.org/6014/44683_A_5_2.jpg Male 46 3184 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_6_5.jpg http://images.proteinatlas.org/6014/44683_A_6_6.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/6014/44683_A_4_1.jpg http://images.proteinatlas.org/6014/44683_A_4_2.jpg Female 60 3517 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/6014/44683_A_4_5.jpg http://images.proteinatlas.org/6014/44683_A_4_6.jpg supported http://v21.proteinatlas.org/images_protein_array/6014_medium.png IGKJ5 Intracellular Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Lung cancer Pancreatic cancer Renal cancer Stomach cancer Testis cancer Urothelial cancer intestine lymphoid tissue salivary gland stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in all B-cells - Transcription Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in all B-cells Detected in single B-cells - Immune response IGKV1-12 IGKV112 L19 Secreted

approved Liver http://images.proteinatlas.org/48721/116217_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Cancer enhanced (stomach cancer) Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter BEWO Daudi RPMI-8226 SH-SY5Y Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1-16 IGKV116 L1 Secreted

approved Liver http://images.proteinatlas.org/48721/116217_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 Detected in single NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1-17 A30 IGKV117 Secreted

approved Liver http://images.proteinatlas.org/48721/116217_A_7_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi K-562 RPMI-8226 SH-SY5Y Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1-27 A20 IGKV127 Secreted

approved Liver http://images.proteinatlas.org/48721/116217_A_9_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Olfactory bulb Pituitary gland Pons Retina Spinal cord Thalamus White matter Amygdala Caudate Cerebellum Cingulate cortex Corpus callosum Dorsal hippocampus Dorsal spinal cord Entorhinal cortex Hypothalamus Insular cortex Medulla oblongata Midbrain Motor cortex Occipital cortex Olfactory bulb Periaqueductal gray Pituitary gland Pons Prefrontal cortex Putamen Retina Retrosplenial cortex Septum Somatosensory cortex Subiculum Substantia nigra Superior colliculi Temporal cortex Thalamus Ventral hippocampus Ventral pallidum Ventral spinal cord BEWO Detected in single BEWO - Transcription regulation A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Not done http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1-33 IGKV133 O18 Intracellular, Secreted (different isoforms)

approved Liver http://images.proteinatlas.org/48721/116217_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Cancer enhanced (stomach cancer) Detected in many Breast cancer Cervical cancer Colorectal cancer Head and neck cancer Lung cancer Ovarian cancer Pancreatic cancer Stomach cancer Testis cancer Urothelial cancer lymphoid tissue stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta spinal cord Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 SCLC-21H SH-SY5Y U-251 MG Detected in some SH-SY5Y - Nervous system development A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Transcription Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Not done http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1-6 Secreted

approved Liver http://images.proteinatlas.org/48721/116217_A_9_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1-9 IGKV19 L8 Secreted

approved Liver http://images.proteinatlas.org/48721/116217_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta cerebral cortex Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter HL-60 NB-4 RPMI-8226 TIME Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1D-33 Intracellular, Secreted (different isoforms)

approved Liver http://images.proteinatlas.org/48721/116217_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Cancer enhanced (stomach cancer) Detected in many Breast cancer Cervical cancer Colorectal cancer Head and neck cancer Lung cancer Ovarian cancer Pancreatic cancer Stomach cancer Testis cancer intestine lymphoid tissue salivary gland Detected in many Macrophages - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Adaptive immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Not done http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV1D-39 Secreted

approved Liver http://images.proteinatlas.org/48721/116217_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/48721/116217_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/48721/116217_A_9_5_rna_selected.jpg Testis http://images.proteinatlas.org/48721/116217_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/48721/116217_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/48721/116217_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Cancer enhanced (stomach cancer) Detected in many Breast cancer Cervical cancer Colorectal cancer Head and neck cancer Lung cancer Ovarian cancer Pancreatic cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Adaptive immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response CDIQMTQSPSSLSASVGDRVTITCR

approved No tissue staining or RNA expression data available for comparison Not done http://images.proteinatlas.org/48721/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Adrenal gland Glandular cells not detected negative none none Female 58 32 http://images.proteinatlas.org/48721/116217_B_6_5.jpg Female 41 118 http://images.proteinatlas.org/48721/116217_B_5_5.jpg Female 52 1263 http://images.proteinatlas.org/48721/116217_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 83 1962 http://images.proteinatlas.org/48721/116217_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/48721/116217_A_1_2.jpg Bone marrow Hematopoietic cells medium moderate >75% cytoplasmic/membranous Male 70 3620 http://images.proteinatlas.org/48721/116217_B_6_4.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/48721/116217_B_5_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate >75% cytoplasmic/membranous Myoepithelial cells medium moderate >75% cytoplasmic/membranous Female 45 3544 http://images.proteinatlas.org/48721/116217_B_2_4.jpg Bronchus Respiratory epithelial cells low weak 75%-25% cytoplasmic/membranous Female 70 3986 http://images.proteinatlas.org/48721/116217_B_6_2.jpg Caudate Glial cells not detected weak <25% cytoplasmic/membranous Neuronal cells not detected weak <25% cytoplasmic/membranous Male 25 3644 http://images.proteinatlas.org/48721/116217_B_8_7.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_7.jpg Male 58 4620 http://images.proteinatlas.org/48721/116217_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 29 166 http://images.proteinatlas.org/48721/116217_B_9_8.jpg Female 54 2523 http://images.proteinatlas.org/48721/116217_B_8_8.jpg Male 54 3643 http://images.proteinatlas.org/48721/116217_B_7_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Neuropil not detected negative none none Male 6 1371 http://images.proteinatlas.org/48721/116217_B_8_5.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_9_5.jpg Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_5.jpg Cervix Glandular cells not detected weak <25% cytoplasmic/membranous Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Female 47 377 http://images.proteinatlas.org/48721/116217_B_7_3.jpg Female 76 911 http://images.proteinatlas.org/48721/116217_B_9_3.jpg Female 36 3401 http://images.proteinatlas.org/48721/116217_B_8_3.jpg Colon Endothelial cells low weak >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Female 84 1958 http://images.proteinatlas.org/48721/116217_A_9_3.jpg Male 84 1960 http://images.proteinatlas.org/48721/116217_A_8_3.jpg Male 46 4111 http://images.proteinatlas.org/48721/116217_A_7_3.jpg Duodenum Glandular cells not detected weak <25% cytoplasmic/membranous Male 55 1920 http://images.proteinatlas.org/48721/116217_A_9_2.jpg Female 67 3479 http://images.proteinatlas.org/48721/116217_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/48721/116217_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous,nuclear Female 37 974 http://images.proteinatlas.org/48721/116217_B_5_3.jpg Female 61 1185 http://images.proteinatlas.org/48721/116217_B_4_3.jpg Female 36 1317 http://images.proteinatlas.org/48721/116217_B_6_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells low moderate <25% cytoplasmic/membranous Female 34 245 http://images.proteinatlas.org/48721/116217_B_1_3.jpg Female 63 393 http://images.proteinatlas.org/48721/116217_B_2_3.jpg Female 32 965 http://images.proteinatlas.org/48721/116217_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 41 4485 http://images.proteinatlas.org/48721/116217_A_1_6.jpg Male 34 4679 http://images.proteinatlas.org/48721/116217_A_3_6.jpg Male 25 4680 http://images.proteinatlas.org/48721/116217_A_2_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 60 1132 http://images.proteinatlas.org/48721/116217_B_6_1.jpg Male 60 3221 http://images.proteinatlas.org/48721/116217_B_4_1.jpg Fallopian tube Glandular cells low moderate <25% cytoplasmic/membranous Female 59 2044 http://images.proteinatlas.org/48721/116217_A_7_7.jpg Female 37 2457 http://images.proteinatlas.org/48721/116217_A_9_7.jpg Female 26 4490 http://images.proteinatlas.org/48721/116217_A_8_7.jpg Gallbladder Glandular cells low moderate <25% cytoplasmic/membranous Male 17 1602 http://images.proteinatlas.org/48721/116217_A_5_4.jpg Female 61 3215 http://images.proteinatlas.org/48721/116217_A_6_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_4_4.jpg Heart muscle Cardiomyocytes low moderate <25% cytoplasmic/membranous Male 54 3643 http://images.proteinatlas.org/48721/116217_B_4_6.jpg Male 37 3731 http://images.proteinatlas.org/48721/116217_B_6_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 70 3739 http://images.proteinatlas.org/48721/116217_B_7_6.jpg Female 52 3740 http://images.proteinatlas.org/48721/116217_B_8_6.jpg Male 37 4624 http://images.proteinatlas.org/48721/116217_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 61 1859 http://images.proteinatlas.org/48721/116217_A_7_5.jpg Male 1 2000 http://images.proteinatlas.org/48721/116217_A_8_5.jpg Female 41 2530 http://images.proteinatlas.org/48721/116217_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 67 1720 http://images.proteinatlas.org/48721/116217_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/48721/116217_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/48721/116217_A_7_4.jpg Lung Alveolar cells medium moderate >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 65 1470 http://images.proteinatlas.org/48721/116217_A_3_4.jpg Female 57 1678 http://images.proteinatlas.org/48721/116217_A_2_4.jpg Female 67 2208 http://images.proteinatlas.org/48721/116217_A_1_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 30 4451 http://images.proteinatlas.org/48721/116217_A_7_8.jpg Male 62 4454 http://images.proteinatlas.org/48721/116217_A_8_8.jpg Female 42 4455 http://images.proteinatlas.org/48721/116217_A_9_8.jpg Nasopharynx Respiratory epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 63 2692 http://images.proteinatlas.org/48721/116217_B_9_2.jpg Male 65 3813 http://images.proteinatlas.org/48721/116217_B_7_2.jpg Oral mucosa Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4109 http://images.proteinatlas.org/48721/116217_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/48721/116217_A_7_1.jpg Male 76 4602 http://images.proteinatlas.org/48721/116217_A_8_1.jpg Ovary Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 51 1808 http://images.proteinatlas.org/48721/116217_A_6_7.jpg Female 39 2380 http://images.proteinatlas.org/48721/116217_A_4_7.jpg Female 39 4395 http://images.proteinatlas.org/48721/116217_A_5_7.jpg Pancreas Exocrine glandular cells medium strong <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 74 2162 http://images.proteinatlas.org/48721/116217_A_2_3.jpg Male 54 2562 http://images.proteinatlas.org/48721/116217_A_3_3.jpg Male 35 3219 http://images.proteinatlas.org/48721/116217_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/48721/116217_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 39 1468 http://images.proteinatlas.org/48721/116217_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/48721/116217_A_1_7.jpg Female 32 4370 http://images.proteinatlas.org/48721/116217_A_2_7.jpg Prostate Glandular cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/48721/116217_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/48721/116217_A_1_5.jpg Male 37 3497 http://images.proteinatlas.org/48721/116217_A_2_5.jpg Rectum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 57 3264 http://images.proteinatlas.org/48721/116217_A_5_3.jpg Female 69 4185 http://images.proteinatlas.org/48721/116217_A_4_3.jpg Female 58 4489 http://images.proteinatlas.org/48721/116217_A_6_3.jpg Salivary gland Glandular cells low moderate <25% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_1_1.jpg Male 82 709 http://images.proteinatlas.org/48721/116217_B_2_1.jpg Male 80 4533 http://images.proteinatlas.org/48721/116217_B_3_1.jpg Seminal vesicle Glandular cells not detected weak <25% cytoplasmic/membranous Male 58 3959 http://images.proteinatlas.org/48721/116217_A_9_6.jpg Male 67 3977 http://images.proteinatlas.org/48721/116217_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 66 2547 http://images.proteinatlas.org/48721/116217_B_3_6.jpg Male 25 3644 http://images.proteinatlas.org/48721/116217_B_1_6.jpg Female 64 3732 http://images.proteinatlas.org/48721/116217_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low moderate <25% cytoplasmic/membranous Langerhans low moderate <25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 80 967 http://images.proteinatlas.org/48721/116217_B_9_1.jpg Male 79 2740 http://images.proteinatlas.org/48721/116217_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/48721/116217_B_8_1.jpg Skin 2 Epidermal cells low moderate <25% cytoplasmic/membranous Female 86 1813 http://images.proteinatlas.org/48721/116217_B_6_8.jpg Male 80 3212 http://images.proteinatlas.org/48721/116217_B_4_8.jpg Male 60 3213 http://images.proteinatlas.org/48721/116217_B_5_8.jpg Small intestine Glandular cells not detected weak <25% cytoplasmic/membranous Male 70 1919 http://images.proteinatlas.org/48721/116217_A_6_2.jpg Female 64 2450 http://images.proteinatlas.org/48721/116217_A_5_2.jpg Female 68 3852 http://images.proteinatlas.org/48721/116217_A_4_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/48721/116217_B_4_7.jpg Female 39 2225 http://images.proteinatlas.org/48721/116217_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 72 4123 http://images.proteinatlas.org/48721/116217_B_3_8.jpg Male 80 4479 http://images.proteinatlas.org/48721/116217_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 74 344 http://images.proteinatlas.org/48721/116217_B_3_7.jpg Female 77 695 http://images.proteinatlas.org/48721/116217_B_2_7.jpg Male 46 4057 http://images.proteinatlas.org/48721/116217_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Male 57 96 http://images.proteinatlas.org/48721/116217_B_7_4.jpg Female 70 941 http://images.proteinatlas.org/48721/116217_B_8_4.jpg Female 74 2162 http://images.proteinatlas.org/48721/116217_B_9_4.jpg Stomach 1 Glandular cells not detected weak <25% cytoplasmic/membranous Male 57 1884 http://images.proteinatlas.org/48721/116217_A_5_1.jpg Male 62 2105 http://images.proteinatlas.org/48721/116217_A_4_1.jpg Male 52 3315 http://images.proteinatlas.org/48721/116217_A_6_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/48721/116217_A_2_1.jpg Male 68 2471 http://images.proteinatlas.org/48721/116217_A_3_1.jpg Male 67 3379 http://images.proteinatlas.org/48721/116217_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 26 2071 http://images.proteinatlas.org/48721/116217_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/48721/116217_A_5_6.jpg Male 41 4485 http://images.proteinatlas.org/48721/116217_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Female 46 59 http://images.proteinatlas.org/48721/116217_B_3_5.jpg Female 42 620 http://images.proteinatlas.org/48721/116217_B_1_5.jpg Female 31 1107 http://images.proteinatlas.org/48721/116217_B_2_5.jpg Tonsil Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells low moderate <25% cytoplasmic/membranous Male 17 1675 http://images.proteinatlas.org/48721/116217_A_6_8.jpg Male 27 2513 http://images.proteinatlas.org/48721/116217_A_5_8.jpg Female 10 3997 http://images.proteinatlas.org/48721/116217_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 55 1798 http://images.proteinatlas.org/48721/116217_A_5_5.jpg Male 64 2839 http://images.proteinatlas.org/48721/116217_A_6_5.jpg Male 69 3549 http://images.proteinatlas.org/48721/116217_A_4_5.jpg Vagina Squamous epithelial cells low moderate <25% cytoplasmic/membranous Female 59 4491 http://images.proteinatlas.org/48721/116217_B_2_2.jpg Female 56 4493 http://images.proteinatlas.org/48721/116217_B_1_2.jpg Female 47 4771 http://images.proteinatlas.org/48721/116217_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 55 1775 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_5_7.jpg http://images.proteinatlas.org/48721/116282_A_5_8.jpg Female 80 1874 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_1.jpg http://images.proteinatlas.org/48721/116282_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_4_7.jpg http://images.proteinatlas.org/48721/116282_A_4_8.jpg Female 61 1910 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_1.jpg http://images.proteinatlas.org/48721/116282_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_1.jpg http://images.proteinatlas.org/48721/116282_A_5_2.jpg Female 83 2160 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_4_5.jpg http://images.proteinatlas.org/48721/116282_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_3.jpg http://images.proteinatlas.org/48721/116282_A_5_4.jpg Female 51 2565 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_6_7.jpg http://images.proteinatlas.org/48721/116282_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_3.jpg http://images.proteinatlas.org/48721/116282_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_5_5.jpg http://images.proteinatlas.org/48721/116282_A_5_6.jpg Carcinoid Tumor cells medium low not detected Female 54 2088 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116197_A_1_1.jpg http://images.proteinatlas.org/48721/116197_A_1_2.jpg Male 41 2618 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_1_7.jpg http://images.proteinatlas.org/48721/116197_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_3.jpg http://images.proteinatlas.org/48721/116197_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_1_5.jpg http://images.proteinatlas.org/48721/116197_A_1_6.jpg Cervical cancer Tumor cells low not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_4_1.jpg http://images.proteinatlas.org/48721/116282_B_4_2.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_7.jpg http://images.proteinatlas.org/48721/116282_B_6_8.jpg Female 52 2986 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_5.jpg http://images.proteinatlas.org/48721/116282_B_5_6.jpg Female 42 3349 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_5.jpg http://images.proteinatlas.org/48721/116282_B_6_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_5_3.jpg http://images.proteinatlas.org/48721/116282_B_5_4.jpg Female 36 4221 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_5.jpg http://images.proteinatlas.org/48721/116282_B_4_6.jpg Female 44 4225 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_4_3.jpg http://images.proteinatlas.org/48721/116282_B_4_4.jpg Female 44 4266 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_6_1.jpg http://images.proteinatlas.org/48721/116282_B_6_2.jpg Female 30 4496 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_5_7.jpg http://images.proteinatlas.org/48721/116282_B_5_8.jpg Female 51 4618 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_6_3.jpg http://images.proteinatlas.org/48721/116282_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 87 1811 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_5.jpg http://images.proteinatlas.org/48721/116282_A_2_6.jpg Male 71 1898 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_3.jpg http://images.proteinatlas.org/48721/116282_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_1_5.jpg http://images.proteinatlas.org/48721/116282_A_1_6.jpg Male 83 1962 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_3.jpg http://images.proteinatlas.org/48721/116282_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_2_7.jpg http://images.proteinatlas.org/48721/116282_A_2_8.jpg Male 77 2931 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_2.jpg Male 83 2947 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_7.jpg http://images.proteinatlas.org/48721/116282_A_3_8.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_5.jpg http://images.proteinatlas.org/48721/116282_A_3_6.jpg Female 67 4089 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_1.jpg http://images.proteinatlas.org/48721/116282_A_3_2.jpg Female 86 4094 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_3_3.jpg http://images.proteinatlas.org/48721/116282_A_3_4.jpg Female 43 4382 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_1_7.jpg http://images.proteinatlas.org/48721/116282_A_1_8.jpg Female 48 4606 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_2_1.jpg http://images.proteinatlas.org/48721/116282_A_2_2.jpg Endometrial cancer Tumor cells high medium low not detected Female 60 1328 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_8_1.jpg http://images.proteinatlas.org/48721/116282_B_8_2.jpg Female 55 1739 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_1.jpg http://images.proteinatlas.org/48721/116282_B_7_2.jpg Female 79 2339 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_1.jpg http://images.proteinatlas.org/48721/116282_B_9_2.jpg Female 57 2408 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_3.jpg http://images.proteinatlas.org/48721/116282_B_8_4.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_5.jpg http://images.proteinatlas.org/48721/116282_B_8_6.jpg Female 58 2621 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_3.jpg http://images.proteinatlas.org/48721/116282_B_7_4.jpg Female 70 3367 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_7_5.jpg http://images.proteinatlas.org/48721/116282_B_7_6.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_7.jpg http://images.proteinatlas.org/48721/116282_B_9_8.jpg Female 70 3999 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_9_3.jpg http://images.proteinatlas.org/48721/116282_B_9_4.jpg Female 87 4779 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_9_5.jpg http://images.proteinatlas.org/48721/116282_B_9_6.jpg Female 82 4804 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_8_7.jpg http://images.proteinatlas.org/48721/116282_B_8_8.jpg Glioma Tumor cells low not detected Male 77 46 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_3.jpg Female 32 122 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_4.jpg Female 50 163 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_5.jpg http://images.proteinatlas.org/48721/116197_A_5_6.jpg Male 56 1578 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_6_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_1.jpg http://images.proteinatlas.org/48721/116197_A_4_2.jpg Male 61 2522 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_4.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_7.jpg http://images.proteinatlas.org/48721/116197_A_4_8.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_5_1.jpg http://images.proteinatlas.org/48721/116197_A_5_2.jpg Male 53 3203 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_5_7.jpg http://images.proteinatlas.org/48721/116197_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_6_1.jpg http://images.proteinatlas.org/48721/116197_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_4_6.jpg Head and neck cancer Tumor cells low not detected Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_5.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_2_1.jpg http://images.proteinatlas.org/48721/116197_A_2_2.jpg Female 81 3470 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_7.jpg http://images.proteinatlas.org/48721/116197_A_2_8.jpg Female 59 4109 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_2_3.jpg http://images.proteinatlas.org/48721/116197_A_2_4.jpg Liver cancer Tumor cells medium low not detected Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_4.jpg Female 43 1222 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_7.jpg http://images.proteinatlas.org/48721/116218_B_8_8.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_1.jpg http://images.proteinatlas.org/48721/116218_B_7_2.jpg Male 76 2325 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_8_6.jpg Female 52 2399 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_5.jpg http://images.proteinatlas.org/48721/116218_B_9_6.jpg Male 72 2556 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116218_B_9_3.jpg http://images.proteinatlas.org/48721/116218_B_9_4.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_7_7.jpg http://images.proteinatlas.org/48721/116218_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_9_7.jpg http://images.proteinatlas.org/48721/116218_B_9_8.jpg Male 70 3324 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_9_1.jpg http://images.proteinatlas.org/48721/116218_B_9_2.jpg Male 67 3334 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_3.jpg http://images.proteinatlas.org/48721/116218_B_7_4.jpg Male 59 3625 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_7_5.jpg http://images.proteinatlas.org/48721/116218_B_7_6.jpg Lung cancer Tumor cells medium not detected Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_1_7.jpg http://images.proteinatlas.org/48721/116197_B_1_8.jpg Male 64 1847 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_5.jpg http://images.proteinatlas.org/48721/116197_B_3_6.jpg Male 73 1937 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_1.jpg http://images.proteinatlas.org/48721/116197_B_1_2.jpg Female 54 2393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_4.jpg Female 69 2777 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_3_1.jpg http://images.proteinatlas.org/48721/116197_B_3_2.jpg Male 74 2779 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_1_5.jpg http://images.proteinatlas.org/48721/116197_B_1_6.jpg Male 67 2888 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_3.jpg http://images.proteinatlas.org/48721/116197_B_3_4.jpg Male 49 3003 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_2_1.jpg http://images.proteinatlas.org/48721/116197_B_2_2.jpg Female 73 3144 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_5.jpg http://images.proteinatlas.org/48721/116197_B_2_6.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_2_3.jpg http://images.proteinatlas.org/48721/116197_B_2_4.jpg Female 69 4194 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_3_7.jpg http://images.proteinatlas.org/48721/116197_B_3_8.jpg Lymphoma Tumor cells low not detected Male 8 603 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_1.jpg http://images.proteinatlas.org/48721/116197_A_8_2.jpg Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_7.jpg http://images.proteinatlas.org/48721/116197_A_7_8.jpg Female 57 1655 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_1.jpg http://images.proteinatlas.org/48721/116197_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_5.jpg http://images.proteinatlas.org/48721/116197_A_8_6.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_1.jpg http://images.proteinatlas.org/48721/116197_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_5.jpg http://images.proteinatlas.org/48721/116197_A_9_6.jpg Female 71 3012 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_8_3.jpg http://images.proteinatlas.org/48721/116197_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_7_3.jpg http://images.proteinatlas.org/48721/116197_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_9_3.jpg http://images.proteinatlas.org/48721/116197_A_9_4.jpg Female 56 3343 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_7_5.jpg http://images.proteinatlas.org/48721/116197_A_7_6.jpg Melanoma Tumor cells medium low not detected Male 64 2317 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_6_7.jpg http://images.proteinatlas.org/48721/116197_B_6_8.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_1.jpg http://images.proteinatlas.org/48721/116197_B_4_2.jpg Female 72 3011 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_1.jpg http://images.proteinatlas.org/48721/116197_B_6_2.jpg Male 62 3140 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_7.jpg http://images.proteinatlas.org/48721/116197_B_5_8.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_5_5.jpg Male 44 3361 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_4_3.jpg http://images.proteinatlas.org/48721/116197_B_4_4.jpg Female 72 3611 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_4.jpg Female 91 3887 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_5_1.jpg http://images.proteinatlas.org/48721/116197_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_6_3.jpg http://images.proteinatlas.org/48721/116197_B_6_4.jpg Female 63 4580 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_4_7.jpg Ovarian cancer Tumor cells medium low not detected Female 35 668 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_7.jpg http://images.proteinatlas.org/48721/116282_B_2_8.jpg Female 73 1844 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_1.jpg http://images.proteinatlas.org/48721/116282_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_5.jpg http://images.proteinatlas.org/48721/116282_B_3_6.jpg Female 57 2082 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_2_1.jpg http://images.proteinatlas.org/48721/116282_B_2_2.jpg Female 54 2114 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_7.jpg http://images.proteinatlas.org/48721/116282_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_3_3.jpg http://images.proteinatlas.org/48721/116282_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_1.jpg http://images.proteinatlas.org/48721/116282_B_1_2.jpg Female 69 2391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_1_5.jpg http://images.proteinatlas.org/48721/116282_B_1_6.jpg Female 62 2568 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_B_3_7.jpg http://images.proteinatlas.org/48721/116282_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_3.jpg http://images.proteinatlas.org/48721/116282_B_2_4.jpg Female 67 4604 Not detected Negative None none http://images.proteinatlas.org/48721/116282_B_2_5.jpg http://images.proteinatlas.org/48721/116282_B_2_6.jpg Pancreatic cancer Tumor cells medium not detected Female 61 3614 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_3.jpg http://images.proteinatlas.org/48721/116218_B_5_4.jpg Male 63 3851 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_3.jpg http://images.proteinatlas.org/48721/116218_B_4_4.jpg Male 68 3892 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_8.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_4_5.jpg Male 44 4378 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_6_1.jpg http://images.proteinatlas.org/48721/116218_B_6_2.jpg Male 71 4400 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_1.jpg http://images.proteinatlas.org/48721/116218_B_5_2.jpg Female 72 4555 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_3.jpg http://images.proteinatlas.org/48721/116218_B_6_4.jpg Male 70 4595 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_4_1.jpg http://images.proteinatlas.org/48721/116218_B_4_2.jpg Female 69 4596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_5_5.jpg Male 57 4598 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_7.jpg http://images.proteinatlas.org/48721/116218_B_6_8.jpg Female 63 4599 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_5_7.jpg http://images.proteinatlas.org/48721/116218_B_5_8.jpg Male 61 4694 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_6_6.jpg Prostate cancer Tumor cells low not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_1.jpg http://images.proteinatlas.org/48721/116282_A_8_2.jpg Male 64 4157 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_1.jpg http://images.proteinatlas.org/48721/116282_A_9_2.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_5.jpg http://images.proteinatlas.org/48721/116282_A_8_6.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_8_7.jpg http://images.proteinatlas.org/48721/116282_A_8_8.jpg Male 68 4350 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_7_5.jpg http://images.proteinatlas.org/48721/116282_A_7_6.jpg Male 68 4354 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_7.jpg http://images.proteinatlas.org/48721/116282_A_7_8.jpg Male 69 4356 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_8_3.jpg http://images.proteinatlas.org/48721/116282_A_8_4.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_3.jpg http://images.proteinatlas.org/48721/116282_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_7_1.jpg http://images.proteinatlas.org/48721/116282_A_7_2.jpg Male 42 4439 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116282_A_9_7.jpg http://images.proteinatlas.org/48721/116282_A_9_8.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/48721/116282_A_9_5.jpg Renal cancer Tumor cells high medium low not detected Male 77 1831 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_5.jpg http://images.proteinatlas.org/48721/116252_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_9_3.jpg http://images.proteinatlas.org/48721/116252_A_9_4.jpg Male 63 1969 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_1.jpg http://images.proteinatlas.org/48721/116252_A_9_2.jpg Male 59 2176 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_8.jpg Female 64 2210 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_5.jpg http://images.proteinatlas.org/48721/116252_A_9_6.jpg Male 59 2261 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_1.jpg http://images.proteinatlas.org/48721/116252_A_8_2.jpg Male 80 2477 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_3.jpg http://images.proteinatlas.org/48721/116252_A_8_4.jpg Female 72 2545 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_7_1.jpg http://images.proteinatlas.org/48721/116252_A_7_2.jpg Female 67 3039 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_7_3.jpg http://images.proteinatlas.org/48721/116252_A_7_4.jpg Male 63 3156 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_9_7.jpg http://images.proteinatlas.org/48721/116252_A_9_8.jpg Female 59 3541 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_7_5.jpg http://images.proteinatlas.org/48721/116252_A_7_6.jpg Female 63 3616 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_8_7.jpg http://images.proteinatlas.org/48721/116252_A_8_8.jpg Skin cancer Tumor cells medium low not detected Male 72 252 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_2.jpg Female 89 1208 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_1.jpg Female 86 1357 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_7_3.jpg http://images.proteinatlas.org/48721/116197_B_7_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_9_5.jpg http://images.proteinatlas.org/48721/116197_B_9_6.jpg Male 75 2111 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_8_3.jpg http://images.proteinatlas.org/48721/116197_B_8_4.jpg Male 82 2586 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_5.jpg http://images.proteinatlas.org/48721/116197_B_7_6.jpg Male 93 2809 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_9_8.jpg Male 71 3280 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_7.jpg http://images.proteinatlas.org/48721/116197_B_7_8.jpg Female 65 3726 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_B_7_1.jpg http://images.proteinatlas.org/48721/116197_B_7_2.jpg Female 79 4182 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_7.jpg http://images.proteinatlas.org/48721/116197_B_8_8.jpg Female 87 4391 Not detected Negative None none http://images.proteinatlas.org/48721/116197_B_8_5.jpg http://images.proteinatlas.org/48721/116197_B_8_6.jpg Stomach cancer Tumor cells low not detected Male 71 629 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_7.jpg http://images.proteinatlas.org/48721/116218_B_3_8.jpg Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_2.jpg Male 62 2105 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_7.jpg http://images.proteinatlas.org/48721/116218_B_1_8.jpg Male 62 2142 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_2_7.jpg http://images.proteinatlas.org/48721/116218_B_2_8.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_2_3.jpg http://images.proteinatlas.org/48721/116218_B_2_4.jpg Female 81 2574 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_1_5.jpg http://images.proteinatlas.org/48721/116218_B_1_6.jpg Female 79 2626 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_2.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_3_3.jpg http://images.proteinatlas.org/48721/116218_B_3_4.jpg Male 77 3055 Not detected Negative None none http://images.proteinatlas.org/48721/116218_B_1_3.jpg http://images.proteinatlas.org/48721/116218_B_1_4.jpg Male 55 3492 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116218_B_3_2.jpg Testis cancer Tumor cells high medium low not detected Male 41 1700 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_5.jpg http://images.proteinatlas.org/48721/116252_A_3_6.jpg Male 26 2071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_3.jpg http://images.proteinatlas.org/48721/116252_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_1_6.jpg Male 28 3108 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/48721/116252_A_2_1.jpg http://images.proteinatlas.org/48721/116252_A_2_2.jpg Male 34 3295 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_3_1.jpg Male 34 3613 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_2_5.jpg http://images.proteinatlas.org/48721/116252_A_2_6.jpg Male 37 4587 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_3.jpg http://images.proteinatlas.org/48721/116252_A_2_4.jpg Male 25 4588 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_2_7.jpg http://images.proteinatlas.org/48721/116252_A_2_8.jpg Male 25 4615 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_1_1.jpg http://images.proteinatlas.org/48721/116252_A_1_2.jpg Male 22 4767 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_3_3.jpg http://images.proteinatlas.org/48721/116252_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 61 2072 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_1.jpg http://images.proteinatlas.org/48721/116197_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_7.jpg http://images.proteinatlas.org/48721/116197_A_3_8.jpg Male 75 3107 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116197_A_3_3.jpg http://images.proteinatlas.org/48721/116197_A_3_4.jpg Female 68 4106 Not detected Negative None none http://images.proteinatlas.org/48721/116197_A_3_5.jpg http://images.proteinatlas.org/48721/116197_A_3_6.jpg Urothelial cancer Tumor cells medium low not detected Male 55 751 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_1.jpg http://images.proteinatlas.org/48721/116252_A_5_2.jpg Female 85 1871 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_1.jpg http://images.proteinatlas.org/48721/116252_A_6_2.jpg Male 57 1906 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_5_7.jpg http://images.proteinatlas.org/48721/116252_A_5_8.jpg Male 61 1984 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_8.jpg Male 78 2469 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_3.jpg http://images.proteinatlas.org/48721/116252_A_4_4.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_5_3.jpg Female 78 3111 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_6_7.jpg http://images.proteinatlas.org/48721/116252_A_6_8.jpg Female 60 3517 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/48721/116252_A_4_5.jpg http://images.proteinatlas.org/48721/116252_A_4_6.jpg Male 91 4467 Not detected Negative None none http://images.proteinatlas.org/48721/116252_A_4_1.jpg http://images.proteinatlas.org/48721/116252_A_4_2.jpg supported http://v21.proteinatlas.org/images_protein_array/48721_medium.png IGKV2-24 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter NB-4 Detected in single NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGKV2-28 Secreted Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Head and neck cancer Lung cancer Ovarian cancer Pancreatic cancer Stomach cancer Testis cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter BEWO Daudi HL-60 K-562 NB-4 RPMI-8226 SCLC-21H SH-SY5Y Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 naive B-cell Detected in single B-cells - Adaptive immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGKV3-15 Secreted

approved Liver http://images.proteinatlas.org/47702/108331_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/47702/108331_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/47702/108331_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/47702/108331_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/47702/108331_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/47702/108331_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi K-562 NB-4 RH-30 RPMI-8226 SCLC-21H SH-SY5Y Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in all Plasma cells Detected in some Plasma cells - Humoral immune response GEIVMTQSPATLSLSPGERATLSCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/47702/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Adrenal gland Glandular cells not detected negative none none Male 61 1859 http://images.proteinatlas.org/47702/108331_B_5_5.jpg Female 61 3255 http://images.proteinatlas.org/47702/108331_B_6_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 14 1990 http://images.proteinatlas.org/47702/108331_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/47702/108331_A_1_2.jpg Female 62 2182 http://images.proteinatlas.org/47702/108331_A_2_2.jpg Bone marrow Hematopoietic cells not detected negative none none Female 78 3645 http://images.proteinatlas.org/47702/108331_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/47702/108331_B_5_4.jpg Male 61 3931 http://images.proteinatlas.org/47702/108331_B_6_4.jpg Breast Adipocytes not detected negative none none Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 23 2773 http://images.proteinatlas.org/47702/108331_B_1_4.jpg Female 27 3286 http://images.proteinatlas.org/47702/108331_B_3_4.jpg Female 45 3544 http://images.proteinatlas.org/47702/108331_B_2_4.jpg Bronchus Respiratory epithelial cells not detected negative none none Female 36 1979 http://images.proteinatlas.org/47702/108331_B_5_2.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_6_2.jpg Male 65 3988 http://images.proteinatlas.org/47702/108331_B_4_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected negative none none Male 70 3620 http://images.proteinatlas.org/47702/108331_B_7_7.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_9_7.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 28 3618 http://images.proteinatlas.org/47702/108331_B_9_8.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_7_8.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected negative none none Neuropil not detected negative none none Male 62 1609 http://images.proteinatlas.org/47702/108331_B_9_5.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_8_5.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_5.jpg Cervix Glandular cells not detected negative none none Squamous epithelial cells not detected negative none none Female 57 2102 http://images.proteinatlas.org/47702/108331_B_7_3.jpg Female 42 2451 http://images.proteinatlas.org/47702/108331_B_8_3.jpg Colon Endothelial cells not detected negative none none Glandular cells not detected negative none none Peripheral nerve/ganglion not detected negative none none Male 47 1857 http://images.proteinatlas.org/47702/108331_A_7_3.jpg Female 79 1985 http://images.proteinatlas.org/47702/108331_A_8_3.jpg Female 62 3753 http://images.proteinatlas.org/47702/108331_A_9_3.jpg Duodenum Glandular cells not detected negative none none Male 35 3219 http://images.proteinatlas.org/47702/108331_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/47702/108331_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 33 2941 http://images.proteinatlas.org/47702/108331_B_6_3.jpg Female 34 3214 http://images.proteinatlas.org/47702/108331_B_4_3.jpg Female 24 3364 http://images.proteinatlas.org/47702/108331_B_5_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 48 2355 http://images.proteinatlas.org/47702/108331_B_1_3.jpg Female 65 3998 http://images.proteinatlas.org/47702/108331_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 36 4044 http://images.proteinatlas.org/47702/108331_A_3_6.jpg Male 77 4104 http://images.proteinatlas.org/47702/108331_A_1_6.jpg Esophagus Squamous epithelial cells not detected negative none none Male 60 3221 http://images.proteinatlas.org/47702/108331_B_5_1.jpg Fallopian tube Glandular cells not detected negative none none Female 36 2170 http://images.proteinatlas.org/47702/108331_A_7_7.jpg Female 35 2344 http://images.proteinatlas.org/47702/108331_A_8_7.jpg Female 39 3293 http://images.proteinatlas.org/47702/108331_A_9_7.jpg Gallbladder Glandular cells not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_6_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 65 2465 http://images.proteinatlas.org/47702/108331_B_6_6.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_4_6.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_6.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_6.jpg Female 52 3740 http://images.proteinatlas.org/47702/108331_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules low moderate <25% cytoplasmic/membranous Male 28 1943 http://images.proteinatlas.org/47702/108331_A_8_5.jpg Female 1 2089 http://images.proteinatlas.org/47702/108331_A_7_5.jpg Female 41 2530 http://images.proteinatlas.org/47702/108331_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/47702/108331_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/47702/108331_A_7_4.jpg Lung Alveolar cells not detected negative none none Macrophages not detected negative none none Male 65 1470 http://images.proteinatlas.org/47702/108331_A_3_4.jpg Female 67 2208 http://images.proteinatlas.org/47702/108331_A_1_4.jpg Female 49 2268 http://images.proteinatlas.org/47702/108331_A_2_4.jpg Lymph node Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 53 3285 http://images.proteinatlas.org/47702/108331_A_9_8.jpg Nasopharynx Respiratory epithelial cells not detected negative none none Male 70 3530 http://images.proteinatlas.org/47702/108331_B_9_2.jpg Male 64 3624 http://images.proteinatlas.org/47702/108331_B_8_2.jpg Oral mucosa Squamous epithelial cells not detected negative none none Female 59 4109 http://images.proteinatlas.org/47702/108331_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/47702/108331_A_7_1.jpg Ovary Ovarian stroma cells not detected negative none none Female 33 2159 http://images.proteinatlas.org/47702/108331_A_6_7.jpg Female 39 4395 http://images.proteinatlas.org/47702/108331_A_5_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Male 63 1647 http://images.proteinatlas.org/47702/108331_A_2_3.jpg Female 35 2032 http://images.proteinatlas.org/47702/108331_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/47702/108331_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/47702/108331_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected negative none none Female 35 1814 http://images.proteinatlas.org/47702/108331_A_2_7.jpg Female 18 2390 http://images.proteinatlas.org/47702/108331_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/47702/108331_A_1_7.jpg Prostate Glandular cells not detected negative none none Male 60 2098 http://images.proteinatlas.org/47702/108331_A_2_5.jpg Male 48 2472 http://images.proteinatlas.org/47702/108331_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/47702/108331_A_1_5.jpg Rectum Glandular cells not detected negative none none Female 46 1876 http://images.proteinatlas.org/47702/108331_A_5_3.jpg Male 51 3298 http://images.proteinatlas.org/47702/108331_A_4_3.jpg Salivary gland Glandular cells not detected negative none none Male 63 1845 http://images.proteinatlas.org/47702/108331_B_1_1.jpg Female 33 2048 http://images.proteinatlas.org/47702/108331_B_3_1.jpg Male 62 2367 http://images.proteinatlas.org/47702/108331_B_2_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 67 3914 http://images.proteinatlas.org/47702/108331_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Female 64 1335 http://images.proteinatlas.org/47702/108331_B_2_6.jpg Female 37 1889 http://images.proteinatlas.org/47702/108331_B_1_6.jpg Male 66 2547 http://images.proteinatlas.org/47702/108331_B_3_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected negative none none Langerhans not detected negative none none Melanocytes not detected negative none none Male 62 3610 http://images.proteinatlas.org/47702/108331_B_7_1.jpg Skin 2 Epidermal cells not detected negative none none Female 15 2027 http://images.proteinatlas.org/47702/108331_B_4_8.jpg Female 66 3357 http://images.proteinatlas.org/47702/108331_B_5_8.jpg Small intestine Glandular cells not detected negative none none Male 52 1879 http://images.proteinatlas.org/47702/108331_A_6_2.jpg Male 41 2226 http://images.proteinatlas.org/47702/108331_A_4_2.jpg Female 64 2450 http://images.proteinatlas.org/47702/108331_A_5_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/47702/108331_B_4_7.jpg Female 39 3500 http://images.proteinatlas.org/47702/108331_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/47702/108331_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Female 21 1511 http://images.proteinatlas.org/47702/108331_B_8_4.jpg Male 82 1787 http://images.proteinatlas.org/47702/108331_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/47702/108331_B_9_4.jpg Stomach 1 Glandular cells not detected negative none none Male 68 2471 http://images.proteinatlas.org/47702/108331_A_5_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/47702/108331_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/47702/108331_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 46 2435 http://images.proteinatlas.org/47702/108331_A_6_6.jpg Male 56 3355 http://images.proteinatlas.org/47702/108331_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/47702/108331_A_5_6.jpg Thyroid gland Glandular cells not detected negative none none Male 56 1672 http://images.proteinatlas.org/47702/108331_B_2_5.jpg Female 39 1948 http://images.proteinatlas.org/47702/108331_B_1_5.jpg Female 44 3005 http://images.proteinatlas.org/47702/108331_B_3_5.jpg Tonsil Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells not detected negative none none Female 19 2613 http://images.proteinatlas.org/47702/108331_A_4_8.jpg Female 19 3294 http://images.proteinatlas.org/47702/108331_A_6_8.jpg Urinary bladder Urothelial cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/47702/108331_A_6_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/47702/108331_B_3_2.jpg Female 68 1829 http://images.proteinatlas.org/47702/108331_B_1_2.jpg Female 60 3517 http://images.proteinatlas.org/47702/108331_B_2_2.jpg

Breast cancer Tumor cells low not detected Female 41 1458 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_3.jpg Female 55 1775 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108328_A_5_7.jpg http://images.proteinatlas.org/47702/108328_A_5_8.jpg Female 80 1874 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_1.jpg http://images.proteinatlas.org/47702/108328_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_7.jpg http://images.proteinatlas.org/47702/108328_A_4_8.jpg Female 61 1910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_1.jpg http://images.proteinatlas.org/47702/108328_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_1.jpg http://images.proteinatlas.org/47702/108328_A_5_2.jpg Female 83 2160 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_5.jpg http://images.proteinatlas.org/47702/108328_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_3.jpg http://images.proteinatlas.org/47702/108328_A_5_4.jpg Female 51 2565 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_7.jpg http://images.proteinatlas.org/47702/108328_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_3.jpg http://images.proteinatlas.org/47702/108328_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_5.jpg http://images.proteinatlas.org/47702/108328_A_5_6.jpg Carcinoid Tumor cells not detected Female 54 2088 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_1.jpg http://images.proteinatlas.org/47702/108329_A_1_2.jpg Male 41 2618 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_7.jpg http://images.proteinatlas.org/47702/108329_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_3.jpg http://images.proteinatlas.org/47702/108329_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_5.jpg http://images.proteinatlas.org/47702/108329_A_1_6.jpg Cervical cancer Tumor cells not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_5.jpg http://images.proteinatlas.org/47702/108328_B_5_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_3.jpg http://images.proteinatlas.org/47702/108328_B_6_4.jpg Female 46 3400 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_7.jpg http://images.proteinatlas.org/47702/108328_B_5_8.jpg Female 46 4219 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_1.jpg http://images.proteinatlas.org/47702/108328_B_5_2.jpg Female 36 4221 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_1.jpg http://images.proteinatlas.org/47702/108328_B_6_2.jpg Female 39 4223 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_5.jpg http://images.proteinatlas.org/47702/108328_B_4_6.jpg Female 52 4224 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_7.jpg http://images.proteinatlas.org/47702/108328_B_4_8.jpg Female 44 4225 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_4.jpg Female 70 4226 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_3.jpg http://images.proteinatlas.org/47702/108328_B_5_4.jpg Colorectal cancer Tumor cells not detected Male 87 1811 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_5.jpg http://images.proteinatlas.org/47702/108328_A_2_6.jpg Male 71 1898 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_3.jpg http://images.proteinatlas.org/47702/108328_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_5.jpg http://images.proteinatlas.org/47702/108328_A_1_6.jpg Male 83 1962 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_3.jpg http://images.proteinatlas.org/47702/108328_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_7.jpg http://images.proteinatlas.org/47702/108328_A_2_8.jpg Male 77 2931 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_1.jpg http://images.proteinatlas.org/47702/108328_A_1_2.jpg Male 83 2947 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_7.jpg http://images.proteinatlas.org/47702/108328_A_3_8.jpg Male 72 3074 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_5.jpg http://images.proteinatlas.org/47702/108328_A_3_6.jpg Female 67 4089 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_1.jpg http://images.proteinatlas.org/47702/108328_A_3_2.jpg Female 86 4094 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_3.jpg http://images.proteinatlas.org/47702/108328_A_3_4.jpg Female 43 4382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_7.jpg http://images.proteinatlas.org/47702/108328_A_1_8.jpg Female 48 4606 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_1.jpg http://images.proteinatlas.org/47702/108328_A_2_2.jpg Endometrial cancer Tumor cells not detected Female 56 309 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_1.jpg http://images.proteinatlas.org/47702/108328_B_8_2.jpg Female 68 1128 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_5.jpg http://images.proteinatlas.org/47702/108328_B_7_6.jpg Female 70 2118 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_1.jpg http://images.proteinatlas.org/47702/108328_B_7_2.jpg Female 75 2173 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_7.jpg http://images.proteinatlas.org/47702/108328_B_8_8.jpg Female 79 2339 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_1.jpg http://images.proteinatlas.org/47702/108328_B_9_2.jpg Female 81 2607 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_5.jpg http://images.proteinatlas.org/47702/108328_B_8_6.jpg Female 58 2621 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_3.jpg http://images.proteinatlas.org/47702/108328_B_7_4.jpg Female 32 3036 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_5.jpg http://images.proteinatlas.org/47702/108328_B_9_6.jpg Female 51 3481 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_3.jpg http://images.proteinatlas.org/47702/108328_B_8_4.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_7.jpg http://images.proteinatlas.org/47702/108328_B_9_8.jpg Female 70 3999 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_3.jpg http://images.proteinatlas.org/47702/108328_B_9_4.jpg Female 62 4201 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_7.jpg http://images.proteinatlas.org/47702/108328_B_7_8.jpg Glioma Tumor cells not detected Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_2.jpg Female 39 1613 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_3.jpg http://images.proteinatlas.org/47702/108329_A_4_4.jpg Male 60 1642 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_7.jpg http://images.proteinatlas.org/47702/108329_A_6_8.jpg Female 59 1645 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_5.jpg http://images.proteinatlas.org/47702/108329_A_6_6.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_7.jpg http://images.proteinatlas.org/47702/108329_A_4_8.jpg Female 57 2843 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_3.jpg http://images.proteinatlas.org/47702/108329_A_6_4.jpg Female 1 3023 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_3.jpg http://images.proteinatlas.org/47702/108329_A_5_4.jpg Male 69 3064 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_5.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_1.jpg http://images.proteinatlas.org/47702/108329_A_5_2.jpg Male 53 3203 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_7.jpg http://images.proteinatlas.org/47702/108329_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_1.jpg http://images.proteinatlas.org/47702/108329_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_5.jpg http://images.proteinatlas.org/47702/108329_A_4_6.jpg Head and neck cancer Tumor cells not detected Male 62 1743 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_3.jpg Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_5.jpg http://images.proteinatlas.org/47702/108329_A_2_6.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_1.jpg http://images.proteinatlas.org/47702/108329_A_2_2.jpg Liver cancer Tumor cells not detected Female 53 983 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_3.jpg http://images.proteinatlas.org/47702/108330_B_8_4.jpg Female 58 2177 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_1.jpg http://images.proteinatlas.org/47702/108330_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_1.jpg http://images.proteinatlas.org/47702/108330_B_7_2.jpg Female 52 2399 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_7.jpg http://images.proteinatlas.org/47702/108330_B_8_8.jpg Male 72 2556 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_3.jpg http://images.proteinatlas.org/47702/108330_B_9_4.jpg Male 47 2652 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_5.jpg http://images.proteinatlas.org/47702/108330_B_8_6.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_7.jpg http://images.proteinatlas.org/47702/108330_B_7_8.jpg Male 70 3324 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_1.jpg http://images.proteinatlas.org/47702/108330_B_9_2.jpg Male 67 3334 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_3.jpg http://images.proteinatlas.org/47702/108330_B_7_4.jpg Male 67 3477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_7.jpg http://images.proteinatlas.org/47702/108330_B_9_8.jpg Male 59 3625 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_5.jpg http://images.proteinatlas.org/47702/108330_B_7_6.jpg Female 77 3841 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_5.jpg http://images.proteinatlas.org/47702/108330_B_9_6.jpg Lung cancer Tumor cells not detected Female 76 448 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_5.jpg http://images.proteinatlas.org/47702/108329_B_2_6.jpg Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_7.jpg http://images.proteinatlas.org/47702/108329_B_1_8.jpg Male 64 1847 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_5.jpg http://images.proteinatlas.org/47702/108329_B_3_6.jpg Male 73 1937 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_1.jpg http://images.proteinatlas.org/47702/108329_B_1_2.jpg Female 54 2393 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_3.jpg http://images.proteinatlas.org/47702/108329_B_1_4.jpg Male 65 2567 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_7.jpg http://images.proteinatlas.org/47702/108329_B_2_8.jpg Male 74 2779 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_5.jpg http://images.proteinatlas.org/47702/108329_B_1_6.jpg Male 49 3003 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_1.jpg http://images.proteinatlas.org/47702/108329_B_2_2.jpg Male 66 3185 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_7.jpg http://images.proteinatlas.org/47702/108329_B_3_8.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_3.jpg http://images.proteinatlas.org/47702/108329_B_2_4.jpg Lymphoma Tumor cells not detected Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_7.jpg http://images.proteinatlas.org/47702/108329_A_7_8.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_1.jpg http://images.proteinatlas.org/47702/108329_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_5.jpg http://images.proteinatlas.org/47702/108329_A_8_6.jpg Female 19 1734 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_7.jpg http://images.proteinatlas.org/47702/108329_A_8_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_1.jpg http://images.proteinatlas.org/47702/108329_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_5.jpg http://images.proteinatlas.org/47702/108329_A_9_6.jpg Female 71 3012 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_7.jpg http://images.proteinatlas.org/47702/108329_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_3.jpg http://images.proteinatlas.org/47702/108329_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_3.jpg http://images.proteinatlas.org/47702/108329_A_7_4.jpg Male 13 3166 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_1.jpg http://images.proteinatlas.org/47702/108329_A_8_2.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_3.jpg http://images.proteinatlas.org/47702/108329_A_9_4.jpg Female 53 3285 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_5.jpg http://images.proteinatlas.org/47702/108329_A_7_6.jpg Melanoma Tumor cells not detected Female 81 21 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_7.jpg Male 88 111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_6.jpg Male 64 2317 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_7.jpg http://images.proteinatlas.org/47702/108329_B_6_8.jpg Male 41 2383 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_3.jpg http://images.proteinatlas.org/47702/108329_B_4_4.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_1.jpg http://images.proteinatlas.org/47702/108329_B_4_2.jpg Female 82 3060 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_1.jpg http://images.proteinatlas.org/47702/108329_B_6_2.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_5.jpg http://images.proteinatlas.org/47702/108329_B_5_6.jpg Female 72 3611 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_3.jpg http://images.proteinatlas.org/47702/108329_B_5_4.jpg Female 91 3887 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_1.jpg http://images.proteinatlas.org/47702/108329_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_3.jpg http://images.proteinatlas.org/47702/108329_B_6_4.jpg Male 84 4028 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_5.jpg Ovarian cancer Tumor cells not detected Female 73 1844 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_1.jpg http://images.proteinatlas.org/47702/108328_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_5.jpg http://images.proteinatlas.org/47702/108328_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_1.jpg http://images.proteinatlas.org/47702/108328_B_2_2.jpg Female 54 2114 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_7.jpg http://images.proteinatlas.org/47702/108328_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_3.jpg http://images.proteinatlas.org/47702/108328_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_1.jpg http://images.proteinatlas.org/47702/108328_B_1_2.jpg Female 69 2391 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_5.jpg http://images.proteinatlas.org/47702/108328_B_1_6.jpg Female 62 2568 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_7.jpg http://images.proteinatlas.org/47702/108328_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_3.jpg http://images.proteinatlas.org/47702/108328_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_3.jpg http://images.proteinatlas.org/47702/108328_B_2_4.jpg Female 70 4361 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_7.jpg http://images.proteinatlas.org/47702/108328_B_2_8.jpg Female 61 4369 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_5.jpg http://images.proteinatlas.org/47702/108328_B_2_6.jpg Pancreatic cancer Tumor cells not detected Female 61 3614 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_3.jpg http://images.proteinatlas.org/47702/108330_B_6_4.jpg Female 73 3719 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_1.jpg http://images.proteinatlas.org/47702/108330_B_4_2.jpg Male 63 3851 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_3.jpg http://images.proteinatlas.org/47702/108330_B_4_4.jpg http://images.proteinatlas.org/47702/108330_B_5_5.jpg http://images.proteinatlas.org/47702/108330_B_5_6.jpg Male 68 3892 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_7.jpg http://images.proteinatlas.org/47702/108330_B_4_8.jpg Male 65 4082 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_3.jpg http://images.proteinatlas.org/47702/108330_B_5_4.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_5.jpg http://images.proteinatlas.org/47702/108330_B_4_6.jpg Male 48 4142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_7.jpg http://images.proteinatlas.org/47702/108330_B_5_8.jpg Male 46 4144 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_1.jpg http://images.proteinatlas.org/47702/108330_B_5_2.jpg Male 78 4149 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_5.jpg http://images.proteinatlas.org/47702/108330_B_6_6.jpg Male 72 4154 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_7.jpg http://images.proteinatlas.org/47702/108330_B_6_8.jpg Prostate cancer Tumor cells not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_1.jpg http://images.proteinatlas.org/47702/108328_A_8_2.jpg Male 63 3910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_7.jpg http://images.proteinatlas.org/47702/108328_A_9_8.jpg Male 68 3984 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_3.jpg http://images.proteinatlas.org/47702/108328_A_8_4.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_5.jpg http://images.proteinatlas.org/47702/108328_A_8_6.jpg Male 72 4337 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_7.jpg http://images.proteinatlas.org/47702/108328_A_7_8.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_8.jpg Male 64 4344 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_1.jpg http://images.proteinatlas.org/47702/108328_A_9_2.jpg Male 68 4350 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_5.jpg http://images.proteinatlas.org/47702/108328_A_7_6.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_3.jpg http://images.proteinatlas.org/47702/108328_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_1.jpg http://images.proteinatlas.org/47702/108328_A_7_2.jpg Male 55 4524 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_3.jpg http://images.proteinatlas.org/47702/108328_A_9_4.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_5.jpg http://images.proteinatlas.org/47702/108328_A_9_6.jpg Renal cancer Tumor cells not detected Male 77 1831 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_5.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_3.jpg http://images.proteinatlas.org/47702/108330_A_9_4.jpg Male 63 1969 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_1.jpg http://images.proteinatlas.org/47702/108330_A_9_2.jpg Male 59 2176 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_7.jpg http://images.proteinatlas.org/47702/108330_A_7_8.jpg Female 64 2210 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_5.jpg http://images.proteinatlas.org/47702/108330_A_9_6.jpg Male 59 2261 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_1.jpg http://images.proteinatlas.org/47702/108330_A_8_2.jpg Male 80 2477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_3.jpg http://images.proteinatlas.org/47702/108330_A_8_4.jpg Female 72 2545 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_1.jpg http://images.proteinatlas.org/47702/108330_A_7_2.jpg Female 52 2564 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_3.jpg Male 63 3156 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_7.jpg http://images.proteinatlas.org/47702/108330_A_9_8.jpg Female 59 3541 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_5.jpg http://images.proteinatlas.org/47702/108330_A_7_6.jpg Female 63 3616 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_7.jpg http://images.proteinatlas.org/47702/108330_A_8_8.jpg Skin cancer Tumor cells not detected Male 71 56 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_7.jpg http://images.proteinatlas.org/47702/108329_B_9_8.jpg Female 66 1075 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_2.jpg Female 59 1219 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_6.jpg Male 72 1663 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_5.jpg http://images.proteinatlas.org/47702/108329_B_7_6.jpg Female 84 1983 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_3.jpg http://images.proteinatlas.org/47702/108329_B_8_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_5.jpg http://images.proteinatlas.org/47702/108329_B_9_6.jpg Male 75 2111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_3.jpg http://images.proteinatlas.org/47702/108329_B_7_4.jpg Male 73 2808 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_3.jpg Female 44 3261 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_8.jpg Male 71 3280 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_7.jpg http://images.proteinatlas.org/47702/108329_B_7_8.jpg Female 65 3726 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_2.jpg Stomach cancer Tumor cells not detected Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_7.jpg http://images.proteinatlas.org/47702/108330_B_1_8.jpg Male 76 2066 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_3.jpg http://images.proteinatlas.org/47702/108330_B_1_4.jpg Male 62 2142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_7.jpg http://images.proteinatlas.org/47702/108330_B_2_8.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_6.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_5.jpg http://images.proteinatlas.org/47702/108330_B_3_6.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_3.jpg http://images.proteinatlas.org/47702/108330_B_2_4.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_3.jpg http://images.proteinatlas.org/47702/108330_B_3_4.jpg Female 60 3526 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_5.jpg http://images.proteinatlas.org/47702/108330_B_1_6.jpg Testis cancer Tumor cells low not detected Male 41 1700 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_3_5.jpg http://images.proteinatlas.org/47702/108330_A_3_6.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_3.jpg http://images.proteinatlas.org/47702/108330_A_2_4.jpg Male 26 2071 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_3.jpg http://images.proteinatlas.org/47702/108330_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_5.jpg Male 65 2558 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_7.jpg http://images.proteinatlas.org/47702/108330_A_2_8.jpg Male 28 3108 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_1.jpg http://images.proteinatlas.org/47702/108330_A_2_2.jpg Male 25 3627 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_1.jpg http://images.proteinatlas.org/47702/108330_A_1_2.jpg Male 49 3751 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_5.jpg http://images.proteinatlas.org/47702/108330_A_2_6.jpg Male 45 3893 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_7.jpg http://images.proteinatlas.org/47702/108330_A_1_8.jpg Thyroid cancer Tumor cells not detected Female 72 625 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_5.jpg http://images.proteinatlas.org/47702/108329_A_3_6.jpg Male 52 932 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_1.jpg http://images.proteinatlas.org/47702/108329_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_7.jpg Male 75 3107 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_3.jpg http://images.proteinatlas.org/47702/108329_A_3_4.jpg Urothelial cancer Tumor cells low not detected Male 67 810 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_7.jpg http://images.proteinatlas.org/47702/108330_A_5_8.jpg Male 50 1717 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_5_5.jpg http://images.proteinatlas.org/47702/108330_A_5_6.jpg Female 85 1871 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_1.jpg http://images.proteinatlas.org/47702/108330_A_6_2.jpg Male 78 2469 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_3.jpg http://images.proteinatlas.org/47702/108330_A_4_4.jpg Male 89 2704 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_1.jpg Male 64 2839 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_7.jpg http://images.proteinatlas.org/47702/108330_A_4_8.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_3.jpg http://images.proteinatlas.org/47702/108330_A_5_4.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_1.jpg http://images.proteinatlas.org/47702/108330_A_4_2.jpg Female 63 3516 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_3.jpg http://images.proteinatlas.org/47702/108330_A_6_4.jpg Female 60 3517 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_5.jpg http://images.proteinatlas.org/47702/108330_A_4_6.jpg Female 63 3780 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_8.jpg uncertain http://v21.proteinatlas.org/images_western_blot/47702_medium.jpg approved http://v21.proteinatlas.org/images_protein_array/47702_medium.png IGKV3-7 Secreted

approved Liver http://images.proteinatlas.org/47702/108331_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/47702/108331_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/47702/108331_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/47702/108331_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/47702/108331_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/47702/108331_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single B-cells Plasma cells Detected in some Plasma cells - Humoral immune response GEIVMTQSPATLSLSPGERATLSCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/47702/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Adrenal gland Glandular cells not detected negative none none Male 61 1859 http://images.proteinatlas.org/47702/108331_B_5_5.jpg Female 61 3255 http://images.proteinatlas.org/47702/108331_B_6_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 14 1990 http://images.proteinatlas.org/47702/108331_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/47702/108331_A_1_2.jpg Female 62 2182 http://images.proteinatlas.org/47702/108331_A_2_2.jpg Bone marrow Hematopoietic cells not detected negative none none Female 78 3645 http://images.proteinatlas.org/47702/108331_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/47702/108331_B_5_4.jpg Male 61 3931 http://images.proteinatlas.org/47702/108331_B_6_4.jpg Breast Adipocytes not detected negative none none Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 23 2773 http://images.proteinatlas.org/47702/108331_B_1_4.jpg Female 27 3286 http://images.proteinatlas.org/47702/108331_B_3_4.jpg Female 45 3544 http://images.proteinatlas.org/47702/108331_B_2_4.jpg Bronchus Respiratory epithelial cells not detected negative none none Female 36 1979 http://images.proteinatlas.org/47702/108331_B_5_2.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_6_2.jpg Male 65 3988 http://images.proteinatlas.org/47702/108331_B_4_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected negative none none Male 70 3620 http://images.proteinatlas.org/47702/108331_B_7_7.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_9_7.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 28 3618 http://images.proteinatlas.org/47702/108331_B_9_8.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_7_8.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected negative none none Neuropil not detected negative none none Male 62 1609 http://images.proteinatlas.org/47702/108331_B_9_5.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_8_5.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_5.jpg Cervix Glandular cells not detected negative none none Squamous epithelial cells not detected negative none none Female 57 2102 http://images.proteinatlas.org/47702/108331_B_7_3.jpg Female 42 2451 http://images.proteinatlas.org/47702/108331_B_8_3.jpg Colon Endothelial cells not detected negative none none Glandular cells not detected negative none none Peripheral nerve/ganglion not detected negative none none Male 47 1857 http://images.proteinatlas.org/47702/108331_A_7_3.jpg Female 79 1985 http://images.proteinatlas.org/47702/108331_A_8_3.jpg Female 62 3753 http://images.proteinatlas.org/47702/108331_A_9_3.jpg Duodenum Glandular cells not detected negative none none Male 35 3219 http://images.proteinatlas.org/47702/108331_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/47702/108331_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 33 2941 http://images.proteinatlas.org/47702/108331_B_6_3.jpg Female 34 3214 http://images.proteinatlas.org/47702/108331_B_4_3.jpg Female 24 3364 http://images.proteinatlas.org/47702/108331_B_5_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 48 2355 http://images.proteinatlas.org/47702/108331_B_1_3.jpg Female 65 3998 http://images.proteinatlas.org/47702/108331_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 36 4044 http://images.proteinatlas.org/47702/108331_A_3_6.jpg Male 77 4104 http://images.proteinatlas.org/47702/108331_A_1_6.jpg Esophagus Squamous epithelial cells not detected negative none none Male 60 3221 http://images.proteinatlas.org/47702/108331_B_5_1.jpg Fallopian tube Glandular cells not detected negative none none Female 36 2170 http://images.proteinatlas.org/47702/108331_A_7_7.jpg Female 35 2344 http://images.proteinatlas.org/47702/108331_A_8_7.jpg Female 39 3293 http://images.proteinatlas.org/47702/108331_A_9_7.jpg Gallbladder Glandular cells not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_6_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 65 2465 http://images.proteinatlas.org/47702/108331_B_6_6.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_4_6.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_6.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_6.jpg Female 52 3740 http://images.proteinatlas.org/47702/108331_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules low moderate <25% cytoplasmic/membranous Male 28 1943 http://images.proteinatlas.org/47702/108331_A_8_5.jpg Female 1 2089 http://images.proteinatlas.org/47702/108331_A_7_5.jpg Female 41 2530 http://images.proteinatlas.org/47702/108331_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/47702/108331_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/47702/108331_A_7_4.jpg Lung Alveolar cells not detected negative none none Macrophages not detected negative none none Male 65 1470 http://images.proteinatlas.org/47702/108331_A_3_4.jpg Female 67 2208 http://images.proteinatlas.org/47702/108331_A_1_4.jpg Female 49 2268 http://images.proteinatlas.org/47702/108331_A_2_4.jpg Lymph node Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 53 3285 http://images.proteinatlas.org/47702/108331_A_9_8.jpg Nasopharynx Respiratory epithelial cells not detected negative none none Male 70 3530 http://images.proteinatlas.org/47702/108331_B_9_2.jpg Male 64 3624 http://images.proteinatlas.org/47702/108331_B_8_2.jpg Oral mucosa Squamous epithelial cells not detected negative none none Female 59 4109 http://images.proteinatlas.org/47702/108331_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/47702/108331_A_7_1.jpg Ovary Ovarian stroma cells not detected negative none none Female 33 2159 http://images.proteinatlas.org/47702/108331_A_6_7.jpg Female 39 4395 http://images.proteinatlas.org/47702/108331_A_5_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Male 63 1647 http://images.proteinatlas.org/47702/108331_A_2_3.jpg Female 35 2032 http://images.proteinatlas.org/47702/108331_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/47702/108331_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/47702/108331_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected negative none none Female 35 1814 http://images.proteinatlas.org/47702/108331_A_2_7.jpg Female 18 2390 http://images.proteinatlas.org/47702/108331_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/47702/108331_A_1_7.jpg Prostate Glandular cells not detected negative none none Male 60 2098 http://images.proteinatlas.org/47702/108331_A_2_5.jpg Male 48 2472 http://images.proteinatlas.org/47702/108331_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/47702/108331_A_1_5.jpg Rectum Glandular cells not detected negative none none Female 46 1876 http://images.proteinatlas.org/47702/108331_A_5_3.jpg Male 51 3298 http://images.proteinatlas.org/47702/108331_A_4_3.jpg Salivary gland Glandular cells not detected negative none none Male 63 1845 http://images.proteinatlas.org/47702/108331_B_1_1.jpg Female 33 2048 http://images.proteinatlas.org/47702/108331_B_3_1.jpg Male 62 2367 http://images.proteinatlas.org/47702/108331_B_2_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 67 3914 http://images.proteinatlas.org/47702/108331_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Female 64 1335 http://images.proteinatlas.org/47702/108331_B_2_6.jpg Female 37 1889 http://images.proteinatlas.org/47702/108331_B_1_6.jpg Male 66 2547 http://images.proteinatlas.org/47702/108331_B_3_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected negative none none Langerhans not detected negative none none Melanocytes not detected negative none none Male 62 3610 http://images.proteinatlas.org/47702/108331_B_7_1.jpg Skin 2 Epidermal cells not detected negative none none Female 15 2027 http://images.proteinatlas.org/47702/108331_B_4_8.jpg Female 66 3357 http://images.proteinatlas.org/47702/108331_B_5_8.jpg Small intestine Glandular cells not detected negative none none Male 52 1879 http://images.proteinatlas.org/47702/108331_A_6_2.jpg Male 41 2226 http://images.proteinatlas.org/47702/108331_A_4_2.jpg Female 64 2450 http://images.proteinatlas.org/47702/108331_A_5_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/47702/108331_B_4_7.jpg Female 39 3500 http://images.proteinatlas.org/47702/108331_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/47702/108331_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Female 21 1511 http://images.proteinatlas.org/47702/108331_B_8_4.jpg Male 82 1787 http://images.proteinatlas.org/47702/108331_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/47702/108331_B_9_4.jpg Stomach 1 Glandular cells not detected negative none none Male 68 2471 http://images.proteinatlas.org/47702/108331_A_5_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/47702/108331_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/47702/108331_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 46 2435 http://images.proteinatlas.org/47702/108331_A_6_6.jpg Male 56 3355 http://images.proteinatlas.org/47702/108331_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/47702/108331_A_5_6.jpg Thyroid gland Glandular cells not detected negative none none Male 56 1672 http://images.proteinatlas.org/47702/108331_B_2_5.jpg Female 39 1948 http://images.proteinatlas.org/47702/108331_B_1_5.jpg Female 44 3005 http://images.proteinatlas.org/47702/108331_B_3_5.jpg Tonsil Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells not detected negative none none Female 19 2613 http://images.proteinatlas.org/47702/108331_A_4_8.jpg Female 19 3294 http://images.proteinatlas.org/47702/108331_A_6_8.jpg Urinary bladder Urothelial cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/47702/108331_A_6_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/47702/108331_B_3_2.jpg Female 68 1829 http://images.proteinatlas.org/47702/108331_B_1_2.jpg Female 60 3517 http://images.proteinatlas.org/47702/108331_B_2_2.jpg

Breast cancer Tumor cells low not detected Female 41 1458 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_3.jpg Female 55 1775 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108328_A_5_7.jpg http://images.proteinatlas.org/47702/108328_A_5_8.jpg Female 80 1874 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_1.jpg http://images.proteinatlas.org/47702/108328_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_7.jpg http://images.proteinatlas.org/47702/108328_A_4_8.jpg Female 61 1910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_1.jpg http://images.proteinatlas.org/47702/108328_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_1.jpg http://images.proteinatlas.org/47702/108328_A_5_2.jpg Female 83 2160 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_5.jpg http://images.proteinatlas.org/47702/108328_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_3.jpg http://images.proteinatlas.org/47702/108328_A_5_4.jpg Female 51 2565 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_7.jpg http://images.proteinatlas.org/47702/108328_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_3.jpg http://images.proteinatlas.org/47702/108328_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_5.jpg http://images.proteinatlas.org/47702/108328_A_5_6.jpg Carcinoid Tumor cells not detected Female 54 2088 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_1.jpg http://images.proteinatlas.org/47702/108329_A_1_2.jpg Male 41 2618 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_7.jpg http://images.proteinatlas.org/47702/108329_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_3.jpg http://images.proteinatlas.org/47702/108329_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_5.jpg http://images.proteinatlas.org/47702/108329_A_1_6.jpg Cervical cancer Tumor cells not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_5.jpg http://images.proteinatlas.org/47702/108328_B_5_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_3.jpg http://images.proteinatlas.org/47702/108328_B_6_4.jpg Female 46 3400 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_7.jpg http://images.proteinatlas.org/47702/108328_B_5_8.jpg Female 46 4219 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_1.jpg http://images.proteinatlas.org/47702/108328_B_5_2.jpg Female 36 4221 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_1.jpg http://images.proteinatlas.org/47702/108328_B_6_2.jpg Female 39 4223 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_5.jpg http://images.proteinatlas.org/47702/108328_B_4_6.jpg Female 52 4224 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_7.jpg http://images.proteinatlas.org/47702/108328_B_4_8.jpg Female 44 4225 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_4.jpg Female 70 4226 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_3.jpg http://images.proteinatlas.org/47702/108328_B_5_4.jpg Colorectal cancer Tumor cells not detected Male 87 1811 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_5.jpg http://images.proteinatlas.org/47702/108328_A_2_6.jpg Male 71 1898 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_3.jpg http://images.proteinatlas.org/47702/108328_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_5.jpg http://images.proteinatlas.org/47702/108328_A_1_6.jpg Male 83 1962 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_3.jpg http://images.proteinatlas.org/47702/108328_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_7.jpg http://images.proteinatlas.org/47702/108328_A_2_8.jpg Male 77 2931 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_1.jpg http://images.proteinatlas.org/47702/108328_A_1_2.jpg Male 83 2947 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_7.jpg http://images.proteinatlas.org/47702/108328_A_3_8.jpg Male 72 3074 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_5.jpg http://images.proteinatlas.org/47702/108328_A_3_6.jpg Female 67 4089 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_1.jpg http://images.proteinatlas.org/47702/108328_A_3_2.jpg Female 86 4094 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_3.jpg http://images.proteinatlas.org/47702/108328_A_3_4.jpg Female 43 4382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_7.jpg http://images.proteinatlas.org/47702/108328_A_1_8.jpg Female 48 4606 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_1.jpg http://images.proteinatlas.org/47702/108328_A_2_2.jpg Endometrial cancer Tumor cells not detected Female 56 309 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_1.jpg http://images.proteinatlas.org/47702/108328_B_8_2.jpg Female 68 1128 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_5.jpg http://images.proteinatlas.org/47702/108328_B_7_6.jpg Female 70 2118 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_1.jpg http://images.proteinatlas.org/47702/108328_B_7_2.jpg Female 75 2173 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_7.jpg http://images.proteinatlas.org/47702/108328_B_8_8.jpg Female 79 2339 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_1.jpg http://images.proteinatlas.org/47702/108328_B_9_2.jpg Female 81 2607 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_5.jpg http://images.proteinatlas.org/47702/108328_B_8_6.jpg Female 58 2621 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_3.jpg http://images.proteinatlas.org/47702/108328_B_7_4.jpg Female 32 3036 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_5.jpg http://images.proteinatlas.org/47702/108328_B_9_6.jpg Female 51 3481 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_3.jpg http://images.proteinatlas.org/47702/108328_B_8_4.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_7.jpg http://images.proteinatlas.org/47702/108328_B_9_8.jpg Female 70 3999 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_3.jpg http://images.proteinatlas.org/47702/108328_B_9_4.jpg Female 62 4201 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_7.jpg http://images.proteinatlas.org/47702/108328_B_7_8.jpg Glioma Tumor cells not detected Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_2.jpg Female 39 1613 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_3.jpg http://images.proteinatlas.org/47702/108329_A_4_4.jpg Male 60 1642 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_7.jpg http://images.proteinatlas.org/47702/108329_A_6_8.jpg Female 59 1645 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_5.jpg http://images.proteinatlas.org/47702/108329_A_6_6.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_7.jpg http://images.proteinatlas.org/47702/108329_A_4_8.jpg Female 57 2843 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_3.jpg http://images.proteinatlas.org/47702/108329_A_6_4.jpg Female 1 3023 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_3.jpg http://images.proteinatlas.org/47702/108329_A_5_4.jpg Male 69 3064 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_5.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_1.jpg http://images.proteinatlas.org/47702/108329_A_5_2.jpg Male 53 3203 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_7.jpg http://images.proteinatlas.org/47702/108329_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_1.jpg http://images.proteinatlas.org/47702/108329_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_5.jpg http://images.proteinatlas.org/47702/108329_A_4_6.jpg Head and neck cancer Tumor cells not detected Male 62 1743 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_3.jpg Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_5.jpg http://images.proteinatlas.org/47702/108329_A_2_6.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_1.jpg http://images.proteinatlas.org/47702/108329_A_2_2.jpg Liver cancer Tumor cells not detected Female 53 983 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_3.jpg http://images.proteinatlas.org/47702/108330_B_8_4.jpg Female 58 2177 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_1.jpg http://images.proteinatlas.org/47702/108330_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_1.jpg http://images.proteinatlas.org/47702/108330_B_7_2.jpg Female 52 2399 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_7.jpg http://images.proteinatlas.org/47702/108330_B_8_8.jpg Male 72 2556 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_3.jpg http://images.proteinatlas.org/47702/108330_B_9_4.jpg Male 47 2652 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_5.jpg http://images.proteinatlas.org/47702/108330_B_8_6.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_7.jpg http://images.proteinatlas.org/47702/108330_B_7_8.jpg Male 70 3324 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_1.jpg http://images.proteinatlas.org/47702/108330_B_9_2.jpg Male 67 3334 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_3.jpg http://images.proteinatlas.org/47702/108330_B_7_4.jpg Male 67 3477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_7.jpg http://images.proteinatlas.org/47702/108330_B_9_8.jpg Male 59 3625 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_5.jpg http://images.proteinatlas.org/47702/108330_B_7_6.jpg Female 77 3841 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_5.jpg http://images.proteinatlas.org/47702/108330_B_9_6.jpg Lung cancer Tumor cells not detected Female 76 448 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_5.jpg http://images.proteinatlas.org/47702/108329_B_2_6.jpg Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_7.jpg http://images.proteinatlas.org/47702/108329_B_1_8.jpg Male 64 1847 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_5.jpg http://images.proteinatlas.org/47702/108329_B_3_6.jpg Male 73 1937 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_1.jpg http://images.proteinatlas.org/47702/108329_B_1_2.jpg Female 54 2393 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_3.jpg http://images.proteinatlas.org/47702/108329_B_1_4.jpg Male 65 2567 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_7.jpg http://images.proteinatlas.org/47702/108329_B_2_8.jpg Male 74 2779 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_5.jpg http://images.proteinatlas.org/47702/108329_B_1_6.jpg Male 49 3003 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_1.jpg http://images.proteinatlas.org/47702/108329_B_2_2.jpg Male 66 3185 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_7.jpg http://images.proteinatlas.org/47702/108329_B_3_8.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_3.jpg http://images.proteinatlas.org/47702/108329_B_2_4.jpg Lymphoma Tumor cells not detected Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_7.jpg http://images.proteinatlas.org/47702/108329_A_7_8.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_1.jpg http://images.proteinatlas.org/47702/108329_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_5.jpg http://images.proteinatlas.org/47702/108329_A_8_6.jpg Female 19 1734 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_7.jpg http://images.proteinatlas.org/47702/108329_A_8_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_1.jpg http://images.proteinatlas.org/47702/108329_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_5.jpg http://images.proteinatlas.org/47702/108329_A_9_6.jpg Female 71 3012 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_7.jpg http://images.proteinatlas.org/47702/108329_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_3.jpg http://images.proteinatlas.org/47702/108329_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_3.jpg http://images.proteinatlas.org/47702/108329_A_7_4.jpg Male 13 3166 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_1.jpg http://images.proteinatlas.org/47702/108329_A_8_2.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_3.jpg http://images.proteinatlas.org/47702/108329_A_9_4.jpg Female 53 3285 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_5.jpg http://images.proteinatlas.org/47702/108329_A_7_6.jpg Melanoma Tumor cells not detected Female 81 21 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_7.jpg Male 88 111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_6.jpg Male 64 2317 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_7.jpg http://images.proteinatlas.org/47702/108329_B_6_8.jpg Male 41 2383 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_3.jpg http://images.proteinatlas.org/47702/108329_B_4_4.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_1.jpg http://images.proteinatlas.org/47702/108329_B_4_2.jpg Female 82 3060 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_1.jpg http://images.proteinatlas.org/47702/108329_B_6_2.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_5.jpg http://images.proteinatlas.org/47702/108329_B_5_6.jpg Female 72 3611 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_3.jpg http://images.proteinatlas.org/47702/108329_B_5_4.jpg Female 91 3887 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_1.jpg http://images.proteinatlas.org/47702/108329_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_3.jpg http://images.proteinatlas.org/47702/108329_B_6_4.jpg Male 84 4028 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_5.jpg Ovarian cancer Tumor cells not detected Female 73 1844 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_1.jpg http://images.proteinatlas.org/47702/108328_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_5.jpg http://images.proteinatlas.org/47702/108328_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_1.jpg http://images.proteinatlas.org/47702/108328_B_2_2.jpg Female 54 2114 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_7.jpg http://images.proteinatlas.org/47702/108328_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_3.jpg http://images.proteinatlas.org/47702/108328_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_1.jpg http://images.proteinatlas.org/47702/108328_B_1_2.jpg Female 69 2391 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_5.jpg http://images.proteinatlas.org/47702/108328_B_1_6.jpg Female 62 2568 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_7.jpg http://images.proteinatlas.org/47702/108328_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_3.jpg http://images.proteinatlas.org/47702/108328_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_3.jpg http://images.proteinatlas.org/47702/108328_B_2_4.jpg Female 70 4361 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_7.jpg http://images.proteinatlas.org/47702/108328_B_2_8.jpg Female 61 4369 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_5.jpg http://images.proteinatlas.org/47702/108328_B_2_6.jpg Pancreatic cancer Tumor cells not detected Female 61 3614 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_3.jpg http://images.proteinatlas.org/47702/108330_B_6_4.jpg Female 73 3719 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_1.jpg http://images.proteinatlas.org/47702/108330_B_4_2.jpg Male 63 3851 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_3.jpg http://images.proteinatlas.org/47702/108330_B_4_4.jpg http://images.proteinatlas.org/47702/108330_B_5_5.jpg http://images.proteinatlas.org/47702/108330_B_5_6.jpg Male 68 3892 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_7.jpg http://images.proteinatlas.org/47702/108330_B_4_8.jpg Male 65 4082 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_3.jpg http://images.proteinatlas.org/47702/108330_B_5_4.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_5.jpg http://images.proteinatlas.org/47702/108330_B_4_6.jpg Male 48 4142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_7.jpg http://images.proteinatlas.org/47702/108330_B_5_8.jpg Male 46 4144 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_1.jpg http://images.proteinatlas.org/47702/108330_B_5_2.jpg Male 78 4149 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_5.jpg http://images.proteinatlas.org/47702/108330_B_6_6.jpg Male 72 4154 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_7.jpg http://images.proteinatlas.org/47702/108330_B_6_8.jpg Prostate cancer Tumor cells not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_1.jpg http://images.proteinatlas.org/47702/108328_A_8_2.jpg Male 63 3910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_7.jpg http://images.proteinatlas.org/47702/108328_A_9_8.jpg Male 68 3984 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_3.jpg http://images.proteinatlas.org/47702/108328_A_8_4.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_5.jpg http://images.proteinatlas.org/47702/108328_A_8_6.jpg Male 72 4337 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_7.jpg http://images.proteinatlas.org/47702/108328_A_7_8.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_8.jpg Male 64 4344 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_1.jpg http://images.proteinatlas.org/47702/108328_A_9_2.jpg Male 68 4350 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_5.jpg http://images.proteinatlas.org/47702/108328_A_7_6.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_3.jpg http://images.proteinatlas.org/47702/108328_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_1.jpg http://images.proteinatlas.org/47702/108328_A_7_2.jpg Male 55 4524 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_3.jpg http://images.proteinatlas.org/47702/108328_A_9_4.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_5.jpg http://images.proteinatlas.org/47702/108328_A_9_6.jpg Renal cancer Tumor cells not detected Male 77 1831 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_5.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_3.jpg http://images.proteinatlas.org/47702/108330_A_9_4.jpg Male 63 1969 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_1.jpg http://images.proteinatlas.org/47702/108330_A_9_2.jpg Male 59 2176 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_7.jpg http://images.proteinatlas.org/47702/108330_A_7_8.jpg Female 64 2210 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_5.jpg http://images.proteinatlas.org/47702/108330_A_9_6.jpg Male 59 2261 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_1.jpg http://images.proteinatlas.org/47702/108330_A_8_2.jpg Male 80 2477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_3.jpg http://images.proteinatlas.org/47702/108330_A_8_4.jpg Female 72 2545 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_1.jpg http://images.proteinatlas.org/47702/108330_A_7_2.jpg Female 52 2564 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_3.jpg Male 63 3156 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_7.jpg http://images.proteinatlas.org/47702/108330_A_9_8.jpg Female 59 3541 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_5.jpg http://images.proteinatlas.org/47702/108330_A_7_6.jpg Female 63 3616 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_7.jpg http://images.proteinatlas.org/47702/108330_A_8_8.jpg Skin cancer Tumor cells not detected Male 71 56 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_7.jpg http://images.proteinatlas.org/47702/108329_B_9_8.jpg Female 66 1075 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_2.jpg Female 59 1219 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_6.jpg Male 72 1663 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_5.jpg http://images.proteinatlas.org/47702/108329_B_7_6.jpg Female 84 1983 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_3.jpg http://images.proteinatlas.org/47702/108329_B_8_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_5.jpg http://images.proteinatlas.org/47702/108329_B_9_6.jpg Male 75 2111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_3.jpg http://images.proteinatlas.org/47702/108329_B_7_4.jpg Male 73 2808 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_3.jpg Female 44 3261 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_8.jpg Male 71 3280 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_7.jpg http://images.proteinatlas.org/47702/108329_B_7_8.jpg Female 65 3726 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_2.jpg Stomach cancer Tumor cells not detected Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_7.jpg http://images.proteinatlas.org/47702/108330_B_1_8.jpg Male 76 2066 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_3.jpg http://images.proteinatlas.org/47702/108330_B_1_4.jpg Male 62 2142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_7.jpg http://images.proteinatlas.org/47702/108330_B_2_8.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_6.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_5.jpg http://images.proteinatlas.org/47702/108330_B_3_6.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_3.jpg http://images.proteinatlas.org/47702/108330_B_2_4.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_3.jpg http://images.proteinatlas.org/47702/108330_B_3_4.jpg Female 60 3526 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_5.jpg http://images.proteinatlas.org/47702/108330_B_1_6.jpg Testis cancer Tumor cells low not detected Male 41 1700 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_3_5.jpg http://images.proteinatlas.org/47702/108330_A_3_6.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_3.jpg http://images.proteinatlas.org/47702/108330_A_2_4.jpg Male 26 2071 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_3.jpg http://images.proteinatlas.org/47702/108330_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_5.jpg Male 65 2558 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_7.jpg http://images.proteinatlas.org/47702/108330_A_2_8.jpg Male 28 3108 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_1.jpg http://images.proteinatlas.org/47702/108330_A_2_2.jpg Male 25 3627 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_1.jpg http://images.proteinatlas.org/47702/108330_A_1_2.jpg Male 49 3751 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_5.jpg http://images.proteinatlas.org/47702/108330_A_2_6.jpg Male 45 3893 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_7.jpg http://images.proteinatlas.org/47702/108330_A_1_8.jpg Thyroid cancer Tumor cells not detected Female 72 625 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_5.jpg http://images.proteinatlas.org/47702/108329_A_3_6.jpg Male 52 932 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_1.jpg http://images.proteinatlas.org/47702/108329_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_7.jpg Male 75 3107 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_3.jpg http://images.proteinatlas.org/47702/108329_A_3_4.jpg Urothelial cancer Tumor cells low not detected Male 67 810 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_7.jpg http://images.proteinatlas.org/47702/108330_A_5_8.jpg Male 50 1717 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_5_5.jpg http://images.proteinatlas.org/47702/108330_A_5_6.jpg Female 85 1871 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_1.jpg http://images.proteinatlas.org/47702/108330_A_6_2.jpg Male 78 2469 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_3.jpg http://images.proteinatlas.org/47702/108330_A_4_4.jpg Male 89 2704 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_1.jpg Male 64 2839 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_7.jpg http://images.proteinatlas.org/47702/108330_A_4_8.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_3.jpg http://images.proteinatlas.org/47702/108330_A_5_4.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_1.jpg http://images.proteinatlas.org/47702/108330_A_4_2.jpg Female 63 3516 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_3.jpg http://images.proteinatlas.org/47702/108330_A_6_4.jpg Female 60 3517 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_5.jpg http://images.proteinatlas.org/47702/108330_A_4_6.jpg Female 63 3780 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_8.jpg uncertain http://v21.proteinatlas.org/images_western_blot/47702_medium.jpg approved http://v21.proteinatlas.org/images_protein_array/47702_medium.png IGKV3D-15 Secreted

approved Liver http://images.proteinatlas.org/47702/108331_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/47702/108331_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/47702/108331_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/47702/108331_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/47702/108331_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/47702/108331_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter HaCaT HL-60 SiHa Detected in some U-937 - Innate immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response GEIVMTQSPATLSLSPGERATLSCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/47702/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Adrenal gland Glandular cells not detected negative none none Male 61 1859 http://images.proteinatlas.org/47702/108331_B_5_5.jpg Female 61 3255 http://images.proteinatlas.org/47702/108331_B_6_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 14 1990 http://images.proteinatlas.org/47702/108331_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/47702/108331_A_1_2.jpg Female 62 2182 http://images.proteinatlas.org/47702/108331_A_2_2.jpg Bone marrow Hematopoietic cells not detected negative none none Female 78 3645 http://images.proteinatlas.org/47702/108331_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/47702/108331_B_5_4.jpg Male 61 3931 http://images.proteinatlas.org/47702/108331_B_6_4.jpg Breast Adipocytes not detected negative none none Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 23 2773 http://images.proteinatlas.org/47702/108331_B_1_4.jpg Female 27 3286 http://images.proteinatlas.org/47702/108331_B_3_4.jpg Female 45 3544 http://images.proteinatlas.org/47702/108331_B_2_4.jpg Bronchus Respiratory epithelial cells not detected negative none none Female 36 1979 http://images.proteinatlas.org/47702/108331_B_5_2.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_6_2.jpg Male 65 3988 http://images.proteinatlas.org/47702/108331_B_4_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected negative none none Male 70 3620 http://images.proteinatlas.org/47702/108331_B_7_7.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_9_7.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 28 3618 http://images.proteinatlas.org/47702/108331_B_9_8.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_7_8.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected negative none none Neuropil not detected negative none none Male 62 1609 http://images.proteinatlas.org/47702/108331_B_9_5.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_8_5.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_5.jpg Cervix Glandular cells not detected negative none none Squamous epithelial cells not detected negative none none Female 57 2102 http://images.proteinatlas.org/47702/108331_B_7_3.jpg Female 42 2451 http://images.proteinatlas.org/47702/108331_B_8_3.jpg Colon Endothelial cells not detected negative none none Glandular cells not detected negative none none Peripheral nerve/ganglion not detected negative none none Male 47 1857 http://images.proteinatlas.org/47702/108331_A_7_3.jpg Female 79 1985 http://images.proteinatlas.org/47702/108331_A_8_3.jpg Female 62 3753 http://images.proteinatlas.org/47702/108331_A_9_3.jpg Duodenum Glandular cells not detected negative none none Male 35 3219 http://images.proteinatlas.org/47702/108331_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/47702/108331_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 33 2941 http://images.proteinatlas.org/47702/108331_B_6_3.jpg Female 34 3214 http://images.proteinatlas.org/47702/108331_B_4_3.jpg Female 24 3364 http://images.proteinatlas.org/47702/108331_B_5_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 48 2355 http://images.proteinatlas.org/47702/108331_B_1_3.jpg Female 65 3998 http://images.proteinatlas.org/47702/108331_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 36 4044 http://images.proteinatlas.org/47702/108331_A_3_6.jpg Male 77 4104 http://images.proteinatlas.org/47702/108331_A_1_6.jpg Esophagus Squamous epithelial cells not detected negative none none Male 60 3221 http://images.proteinatlas.org/47702/108331_B_5_1.jpg Fallopian tube Glandular cells not detected negative none none Female 36 2170 http://images.proteinatlas.org/47702/108331_A_7_7.jpg Female 35 2344 http://images.proteinatlas.org/47702/108331_A_8_7.jpg Female 39 3293 http://images.proteinatlas.org/47702/108331_A_9_7.jpg Gallbladder Glandular cells not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_6_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 65 2465 http://images.proteinatlas.org/47702/108331_B_6_6.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_4_6.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_6.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_6.jpg Female 52 3740 http://images.proteinatlas.org/47702/108331_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules low moderate <25% cytoplasmic/membranous Male 28 1943 http://images.proteinatlas.org/47702/108331_A_8_5.jpg Female 1 2089 http://images.proteinatlas.org/47702/108331_A_7_5.jpg Female 41 2530 http://images.proteinatlas.org/47702/108331_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/47702/108331_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/47702/108331_A_7_4.jpg Lung Alveolar cells not detected negative none none Macrophages not detected negative none none Male 65 1470 http://images.proteinatlas.org/47702/108331_A_3_4.jpg Female 67 2208 http://images.proteinatlas.org/47702/108331_A_1_4.jpg Female 49 2268 http://images.proteinatlas.org/47702/108331_A_2_4.jpg Lymph node Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 53 3285 http://images.proteinatlas.org/47702/108331_A_9_8.jpg Nasopharynx Respiratory epithelial cells not detected negative none none Male 70 3530 http://images.proteinatlas.org/47702/108331_B_9_2.jpg Male 64 3624 http://images.proteinatlas.org/47702/108331_B_8_2.jpg Oral mucosa Squamous epithelial cells not detected negative none none Female 59 4109 http://images.proteinatlas.org/47702/108331_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/47702/108331_A_7_1.jpg Ovary Ovarian stroma cells not detected negative none none Female 33 2159 http://images.proteinatlas.org/47702/108331_A_6_7.jpg Female 39 4395 http://images.proteinatlas.org/47702/108331_A_5_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Male 63 1647 http://images.proteinatlas.org/47702/108331_A_2_3.jpg Female 35 2032 http://images.proteinatlas.org/47702/108331_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/47702/108331_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/47702/108331_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected negative none none Female 35 1814 http://images.proteinatlas.org/47702/108331_A_2_7.jpg Female 18 2390 http://images.proteinatlas.org/47702/108331_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/47702/108331_A_1_7.jpg Prostate Glandular cells not detected negative none none Male 60 2098 http://images.proteinatlas.org/47702/108331_A_2_5.jpg Male 48 2472 http://images.proteinatlas.org/47702/108331_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/47702/108331_A_1_5.jpg Rectum Glandular cells not detected negative none none Female 46 1876 http://images.proteinatlas.org/47702/108331_A_5_3.jpg Male 51 3298 http://images.proteinatlas.org/47702/108331_A_4_3.jpg Salivary gland Glandular cells not detected negative none none Male 63 1845 http://images.proteinatlas.org/47702/108331_B_1_1.jpg Female 33 2048 http://images.proteinatlas.org/47702/108331_B_3_1.jpg Male 62 2367 http://images.proteinatlas.org/47702/108331_B_2_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 67 3914 http://images.proteinatlas.org/47702/108331_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Female 64 1335 http://images.proteinatlas.org/47702/108331_B_2_6.jpg Female 37 1889 http://images.proteinatlas.org/47702/108331_B_1_6.jpg Male 66 2547 http://images.proteinatlas.org/47702/108331_B_3_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected negative none none Langerhans not detected negative none none Melanocytes not detected negative none none Male 62 3610 http://images.proteinatlas.org/47702/108331_B_7_1.jpg Skin 2 Epidermal cells not detected negative none none Female 15 2027 http://images.proteinatlas.org/47702/108331_B_4_8.jpg Female 66 3357 http://images.proteinatlas.org/47702/108331_B_5_8.jpg Small intestine Glandular cells not detected negative none none Male 52 1879 http://images.proteinatlas.org/47702/108331_A_6_2.jpg Male 41 2226 http://images.proteinatlas.org/47702/108331_A_4_2.jpg Female 64 2450 http://images.proteinatlas.org/47702/108331_A_5_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/47702/108331_B_4_7.jpg Female 39 3500 http://images.proteinatlas.org/47702/108331_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/47702/108331_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Female 21 1511 http://images.proteinatlas.org/47702/108331_B_8_4.jpg Male 82 1787 http://images.proteinatlas.org/47702/108331_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/47702/108331_B_9_4.jpg Stomach 1 Glandular cells not detected negative none none Male 68 2471 http://images.proteinatlas.org/47702/108331_A_5_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/47702/108331_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/47702/108331_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 46 2435 http://images.proteinatlas.org/47702/108331_A_6_6.jpg Male 56 3355 http://images.proteinatlas.org/47702/108331_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/47702/108331_A_5_6.jpg Thyroid gland Glandular cells not detected negative none none Male 56 1672 http://images.proteinatlas.org/47702/108331_B_2_5.jpg Female 39 1948 http://images.proteinatlas.org/47702/108331_B_1_5.jpg Female 44 3005 http://images.proteinatlas.org/47702/108331_B_3_5.jpg Tonsil Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells not detected negative none none Female 19 2613 http://images.proteinatlas.org/47702/108331_A_4_8.jpg Female 19 3294 http://images.proteinatlas.org/47702/108331_A_6_8.jpg Urinary bladder Urothelial cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/47702/108331_A_6_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/47702/108331_B_3_2.jpg Female 68 1829 http://images.proteinatlas.org/47702/108331_B_1_2.jpg Female 60 3517 http://images.proteinatlas.org/47702/108331_B_2_2.jpg

Breast cancer Tumor cells low not detected Female 41 1458 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_3.jpg Female 55 1775 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108328_A_5_7.jpg http://images.proteinatlas.org/47702/108328_A_5_8.jpg Female 80 1874 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_1.jpg http://images.proteinatlas.org/47702/108328_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_7.jpg http://images.proteinatlas.org/47702/108328_A_4_8.jpg Female 61 1910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_1.jpg http://images.proteinatlas.org/47702/108328_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_1.jpg http://images.proteinatlas.org/47702/108328_A_5_2.jpg Female 83 2160 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_5.jpg http://images.proteinatlas.org/47702/108328_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_3.jpg http://images.proteinatlas.org/47702/108328_A_5_4.jpg Female 51 2565 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_7.jpg http://images.proteinatlas.org/47702/108328_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_3.jpg http://images.proteinatlas.org/47702/108328_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_5.jpg http://images.proteinatlas.org/47702/108328_A_5_6.jpg Carcinoid Tumor cells not detected Female 54 2088 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_1.jpg http://images.proteinatlas.org/47702/108329_A_1_2.jpg Male 41 2618 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_7.jpg http://images.proteinatlas.org/47702/108329_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_3.jpg http://images.proteinatlas.org/47702/108329_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_5.jpg http://images.proteinatlas.org/47702/108329_A_1_6.jpg Cervical cancer Tumor cells not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_5.jpg http://images.proteinatlas.org/47702/108328_B_5_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_3.jpg http://images.proteinatlas.org/47702/108328_B_6_4.jpg Female 46 3400 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_7.jpg http://images.proteinatlas.org/47702/108328_B_5_8.jpg Female 46 4219 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_1.jpg http://images.proteinatlas.org/47702/108328_B_5_2.jpg Female 36 4221 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_1.jpg http://images.proteinatlas.org/47702/108328_B_6_2.jpg Female 39 4223 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_5.jpg http://images.proteinatlas.org/47702/108328_B_4_6.jpg Female 52 4224 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_7.jpg http://images.proteinatlas.org/47702/108328_B_4_8.jpg Female 44 4225 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_4.jpg Female 70 4226 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_3.jpg http://images.proteinatlas.org/47702/108328_B_5_4.jpg Colorectal cancer Tumor cells not detected Male 87 1811 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_5.jpg http://images.proteinatlas.org/47702/108328_A_2_6.jpg Male 71 1898 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_3.jpg http://images.proteinatlas.org/47702/108328_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_5.jpg http://images.proteinatlas.org/47702/108328_A_1_6.jpg Male 83 1962 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_3.jpg http://images.proteinatlas.org/47702/108328_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_7.jpg http://images.proteinatlas.org/47702/108328_A_2_8.jpg Male 77 2931 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_1.jpg http://images.proteinatlas.org/47702/108328_A_1_2.jpg Male 83 2947 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_7.jpg http://images.proteinatlas.org/47702/108328_A_3_8.jpg Male 72 3074 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_5.jpg http://images.proteinatlas.org/47702/108328_A_3_6.jpg Female 67 4089 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_1.jpg http://images.proteinatlas.org/47702/108328_A_3_2.jpg Female 86 4094 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_3.jpg http://images.proteinatlas.org/47702/108328_A_3_4.jpg Female 43 4382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_7.jpg http://images.proteinatlas.org/47702/108328_A_1_8.jpg Female 48 4606 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_1.jpg http://images.proteinatlas.org/47702/108328_A_2_2.jpg Endometrial cancer Tumor cells not detected Female 56 309 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_1.jpg http://images.proteinatlas.org/47702/108328_B_8_2.jpg Female 68 1128 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_5.jpg http://images.proteinatlas.org/47702/108328_B_7_6.jpg Female 70 2118 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_1.jpg http://images.proteinatlas.org/47702/108328_B_7_2.jpg Female 75 2173 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_7.jpg http://images.proteinatlas.org/47702/108328_B_8_8.jpg Female 79 2339 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_1.jpg http://images.proteinatlas.org/47702/108328_B_9_2.jpg Female 81 2607 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_5.jpg http://images.proteinatlas.org/47702/108328_B_8_6.jpg Female 58 2621 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_3.jpg http://images.proteinatlas.org/47702/108328_B_7_4.jpg Female 32 3036 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_5.jpg http://images.proteinatlas.org/47702/108328_B_9_6.jpg Female 51 3481 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_3.jpg http://images.proteinatlas.org/47702/108328_B_8_4.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_7.jpg http://images.proteinatlas.org/47702/108328_B_9_8.jpg Female 70 3999 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_3.jpg http://images.proteinatlas.org/47702/108328_B_9_4.jpg Female 62 4201 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_7.jpg http://images.proteinatlas.org/47702/108328_B_7_8.jpg Glioma Tumor cells not detected Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_2.jpg Female 39 1613 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_3.jpg http://images.proteinatlas.org/47702/108329_A_4_4.jpg Male 60 1642 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_7.jpg http://images.proteinatlas.org/47702/108329_A_6_8.jpg Female 59 1645 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_5.jpg http://images.proteinatlas.org/47702/108329_A_6_6.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_7.jpg http://images.proteinatlas.org/47702/108329_A_4_8.jpg Female 57 2843 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_3.jpg http://images.proteinatlas.org/47702/108329_A_6_4.jpg Female 1 3023 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_3.jpg http://images.proteinatlas.org/47702/108329_A_5_4.jpg Male 69 3064 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_5.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_1.jpg http://images.proteinatlas.org/47702/108329_A_5_2.jpg Male 53 3203 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_7.jpg http://images.proteinatlas.org/47702/108329_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_1.jpg http://images.proteinatlas.org/47702/108329_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_5.jpg http://images.proteinatlas.org/47702/108329_A_4_6.jpg Head and neck cancer Tumor cells not detected Male 62 1743 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_3.jpg Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_5.jpg http://images.proteinatlas.org/47702/108329_A_2_6.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_1.jpg http://images.proteinatlas.org/47702/108329_A_2_2.jpg Liver cancer Tumor cells not detected Female 53 983 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_3.jpg http://images.proteinatlas.org/47702/108330_B_8_4.jpg Female 58 2177 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_1.jpg http://images.proteinatlas.org/47702/108330_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_1.jpg http://images.proteinatlas.org/47702/108330_B_7_2.jpg Female 52 2399 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_7.jpg http://images.proteinatlas.org/47702/108330_B_8_8.jpg Male 72 2556 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_3.jpg http://images.proteinatlas.org/47702/108330_B_9_4.jpg Male 47 2652 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_5.jpg http://images.proteinatlas.org/47702/108330_B_8_6.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_7.jpg http://images.proteinatlas.org/47702/108330_B_7_8.jpg Male 70 3324 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_1.jpg http://images.proteinatlas.org/47702/108330_B_9_2.jpg Male 67 3334 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_3.jpg http://images.proteinatlas.org/47702/108330_B_7_4.jpg Male 67 3477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_7.jpg http://images.proteinatlas.org/47702/108330_B_9_8.jpg Male 59 3625 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_5.jpg http://images.proteinatlas.org/47702/108330_B_7_6.jpg Female 77 3841 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_5.jpg http://images.proteinatlas.org/47702/108330_B_9_6.jpg Lung cancer Tumor cells not detected Female 76 448 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_5.jpg http://images.proteinatlas.org/47702/108329_B_2_6.jpg Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_7.jpg http://images.proteinatlas.org/47702/108329_B_1_8.jpg Male 64 1847 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_5.jpg http://images.proteinatlas.org/47702/108329_B_3_6.jpg Male 73 1937 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_1.jpg http://images.proteinatlas.org/47702/108329_B_1_2.jpg Female 54 2393 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_3.jpg http://images.proteinatlas.org/47702/108329_B_1_4.jpg Male 65 2567 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_7.jpg http://images.proteinatlas.org/47702/108329_B_2_8.jpg Male 74 2779 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_5.jpg http://images.proteinatlas.org/47702/108329_B_1_6.jpg Male 49 3003 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_1.jpg http://images.proteinatlas.org/47702/108329_B_2_2.jpg Male 66 3185 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_7.jpg http://images.proteinatlas.org/47702/108329_B_3_8.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_3.jpg http://images.proteinatlas.org/47702/108329_B_2_4.jpg Lymphoma Tumor cells not detected Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_7.jpg http://images.proteinatlas.org/47702/108329_A_7_8.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_1.jpg http://images.proteinatlas.org/47702/108329_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_5.jpg http://images.proteinatlas.org/47702/108329_A_8_6.jpg Female 19 1734 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_7.jpg http://images.proteinatlas.org/47702/108329_A_8_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_1.jpg http://images.proteinatlas.org/47702/108329_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_5.jpg http://images.proteinatlas.org/47702/108329_A_9_6.jpg Female 71 3012 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_7.jpg http://images.proteinatlas.org/47702/108329_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_3.jpg http://images.proteinatlas.org/47702/108329_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_3.jpg http://images.proteinatlas.org/47702/108329_A_7_4.jpg Male 13 3166 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_1.jpg http://images.proteinatlas.org/47702/108329_A_8_2.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_3.jpg http://images.proteinatlas.org/47702/108329_A_9_4.jpg Female 53 3285 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_5.jpg http://images.proteinatlas.org/47702/108329_A_7_6.jpg Melanoma Tumor cells not detected Female 81 21 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_7.jpg Male 88 111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_6.jpg Male 64 2317 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_7.jpg http://images.proteinatlas.org/47702/108329_B_6_8.jpg Male 41 2383 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_3.jpg http://images.proteinatlas.org/47702/108329_B_4_4.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_1.jpg http://images.proteinatlas.org/47702/108329_B_4_2.jpg Female 82 3060 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_1.jpg http://images.proteinatlas.org/47702/108329_B_6_2.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_5.jpg http://images.proteinatlas.org/47702/108329_B_5_6.jpg Female 72 3611 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_3.jpg http://images.proteinatlas.org/47702/108329_B_5_4.jpg Female 91 3887 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_1.jpg http://images.proteinatlas.org/47702/108329_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_3.jpg http://images.proteinatlas.org/47702/108329_B_6_4.jpg Male 84 4028 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_5.jpg Ovarian cancer Tumor cells not detected Female 73 1844 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_1.jpg http://images.proteinatlas.org/47702/108328_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_5.jpg http://images.proteinatlas.org/47702/108328_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_1.jpg http://images.proteinatlas.org/47702/108328_B_2_2.jpg Female 54 2114 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_7.jpg http://images.proteinatlas.org/47702/108328_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_3.jpg http://images.proteinatlas.org/47702/108328_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_1.jpg http://images.proteinatlas.org/47702/108328_B_1_2.jpg Female 69 2391 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_5.jpg http://images.proteinatlas.org/47702/108328_B_1_6.jpg Female 62 2568 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_7.jpg http://images.proteinatlas.org/47702/108328_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_3.jpg http://images.proteinatlas.org/47702/108328_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_3.jpg http://images.proteinatlas.org/47702/108328_B_2_4.jpg Female 70 4361 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_7.jpg http://images.proteinatlas.org/47702/108328_B_2_8.jpg Female 61 4369 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_5.jpg http://images.proteinatlas.org/47702/108328_B_2_6.jpg Pancreatic cancer Tumor cells not detected Female 61 3614 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_3.jpg http://images.proteinatlas.org/47702/108330_B_6_4.jpg Female 73 3719 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_1.jpg http://images.proteinatlas.org/47702/108330_B_4_2.jpg Male 63 3851 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_3.jpg http://images.proteinatlas.org/47702/108330_B_4_4.jpg http://images.proteinatlas.org/47702/108330_B_5_5.jpg http://images.proteinatlas.org/47702/108330_B_5_6.jpg Male 68 3892 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_7.jpg http://images.proteinatlas.org/47702/108330_B_4_8.jpg Male 65 4082 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_3.jpg http://images.proteinatlas.org/47702/108330_B_5_4.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_5.jpg http://images.proteinatlas.org/47702/108330_B_4_6.jpg Male 48 4142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_7.jpg http://images.proteinatlas.org/47702/108330_B_5_8.jpg Male 46 4144 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_1.jpg http://images.proteinatlas.org/47702/108330_B_5_2.jpg Male 78 4149 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_5.jpg http://images.proteinatlas.org/47702/108330_B_6_6.jpg Male 72 4154 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_7.jpg http://images.proteinatlas.org/47702/108330_B_6_8.jpg Prostate cancer Tumor cells not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_1.jpg http://images.proteinatlas.org/47702/108328_A_8_2.jpg Male 63 3910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_7.jpg http://images.proteinatlas.org/47702/108328_A_9_8.jpg Male 68 3984 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_3.jpg http://images.proteinatlas.org/47702/108328_A_8_4.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_5.jpg http://images.proteinatlas.org/47702/108328_A_8_6.jpg Male 72 4337 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_7.jpg http://images.proteinatlas.org/47702/108328_A_7_8.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_8.jpg Male 64 4344 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_1.jpg http://images.proteinatlas.org/47702/108328_A_9_2.jpg Male 68 4350 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_5.jpg http://images.proteinatlas.org/47702/108328_A_7_6.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_3.jpg http://images.proteinatlas.org/47702/108328_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_1.jpg http://images.proteinatlas.org/47702/108328_A_7_2.jpg Male 55 4524 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_3.jpg http://images.proteinatlas.org/47702/108328_A_9_4.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_5.jpg http://images.proteinatlas.org/47702/108328_A_9_6.jpg Renal cancer Tumor cells not detected Male 77 1831 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_5.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_3.jpg http://images.proteinatlas.org/47702/108330_A_9_4.jpg Male 63 1969 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_1.jpg http://images.proteinatlas.org/47702/108330_A_9_2.jpg Male 59 2176 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_7.jpg http://images.proteinatlas.org/47702/108330_A_7_8.jpg Female 64 2210 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_5.jpg http://images.proteinatlas.org/47702/108330_A_9_6.jpg Male 59 2261 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_1.jpg http://images.proteinatlas.org/47702/108330_A_8_2.jpg Male 80 2477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_3.jpg http://images.proteinatlas.org/47702/108330_A_8_4.jpg Female 72 2545 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_1.jpg http://images.proteinatlas.org/47702/108330_A_7_2.jpg Female 52 2564 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_3.jpg Male 63 3156 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_7.jpg http://images.proteinatlas.org/47702/108330_A_9_8.jpg Female 59 3541 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_5.jpg http://images.proteinatlas.org/47702/108330_A_7_6.jpg Female 63 3616 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_7.jpg http://images.proteinatlas.org/47702/108330_A_8_8.jpg Skin cancer Tumor cells not detected Male 71 56 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_7.jpg http://images.proteinatlas.org/47702/108329_B_9_8.jpg Female 66 1075 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_2.jpg Female 59 1219 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_6.jpg Male 72 1663 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_5.jpg http://images.proteinatlas.org/47702/108329_B_7_6.jpg Female 84 1983 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_3.jpg http://images.proteinatlas.org/47702/108329_B_8_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_5.jpg http://images.proteinatlas.org/47702/108329_B_9_6.jpg Male 75 2111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_3.jpg http://images.proteinatlas.org/47702/108329_B_7_4.jpg Male 73 2808 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_3.jpg Female 44 3261 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_8.jpg Male 71 3280 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_7.jpg http://images.proteinatlas.org/47702/108329_B_7_8.jpg Female 65 3726 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_2.jpg Stomach cancer Tumor cells not detected Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_7.jpg http://images.proteinatlas.org/47702/108330_B_1_8.jpg Male 76 2066 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_3.jpg http://images.proteinatlas.org/47702/108330_B_1_4.jpg Male 62 2142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_7.jpg http://images.proteinatlas.org/47702/108330_B_2_8.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_6.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_5.jpg http://images.proteinatlas.org/47702/108330_B_3_6.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_3.jpg http://images.proteinatlas.org/47702/108330_B_2_4.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_3.jpg http://images.proteinatlas.org/47702/108330_B_3_4.jpg Female 60 3526 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_5.jpg http://images.proteinatlas.org/47702/108330_B_1_6.jpg Testis cancer Tumor cells low not detected Male 41 1700 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_3_5.jpg http://images.proteinatlas.org/47702/108330_A_3_6.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_3.jpg http://images.proteinatlas.org/47702/108330_A_2_4.jpg Male 26 2071 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_3.jpg http://images.proteinatlas.org/47702/108330_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_5.jpg Male 65 2558 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_7.jpg http://images.proteinatlas.org/47702/108330_A_2_8.jpg Male 28 3108 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_1.jpg http://images.proteinatlas.org/47702/108330_A_2_2.jpg Male 25 3627 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_1.jpg http://images.proteinatlas.org/47702/108330_A_1_2.jpg Male 49 3751 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_5.jpg http://images.proteinatlas.org/47702/108330_A_2_6.jpg Male 45 3893 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_7.jpg http://images.proteinatlas.org/47702/108330_A_1_8.jpg Thyroid cancer Tumor cells not detected Female 72 625 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_5.jpg http://images.proteinatlas.org/47702/108329_A_3_6.jpg Male 52 932 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_1.jpg http://images.proteinatlas.org/47702/108329_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_7.jpg Male 75 3107 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_3.jpg http://images.proteinatlas.org/47702/108329_A_3_4.jpg Urothelial cancer Tumor cells low not detected Male 67 810 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_7.jpg http://images.proteinatlas.org/47702/108330_A_5_8.jpg Male 50 1717 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_5_5.jpg http://images.proteinatlas.org/47702/108330_A_5_6.jpg Female 85 1871 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_1.jpg http://images.proteinatlas.org/47702/108330_A_6_2.jpg Male 78 2469 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_3.jpg http://images.proteinatlas.org/47702/108330_A_4_4.jpg Male 89 2704 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_1.jpg Male 64 2839 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_7.jpg http://images.proteinatlas.org/47702/108330_A_4_8.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_3.jpg http://images.proteinatlas.org/47702/108330_A_5_4.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_1.jpg http://images.proteinatlas.org/47702/108330_A_4_2.jpg Female 63 3516 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_3.jpg http://images.proteinatlas.org/47702/108330_A_6_4.jpg Female 60 3517 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_5.jpg http://images.proteinatlas.org/47702/108330_A_4_6.jpg Female 63 3780 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_8.jpg uncertain http://v21.proteinatlas.org/images_western_blot/47702_medium.jpg approved http://v21.proteinatlas.org/images_protein_array/47702_medium.png IGKV3D-20 Secreted

approved Liver http://images.proteinatlas.org/47702/108331_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/47702/108331_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/47702/108331_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/47702/108331_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/47702/108331_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/47702/108331_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter U-266/70 Detected in some U-266 - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response GEIVMTQSPATLSLSPGERATLSCR

approved No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/47702/ihc_selected.jpg Adipose tissue Adipocytes not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Adrenal gland Glandular cells not detected negative none none Male 61 1859 http://images.proteinatlas.org/47702/108331_B_5_5.jpg Female 61 3255 http://images.proteinatlas.org/47702/108331_B_6_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 14 1990 http://images.proteinatlas.org/47702/108331_A_3_2.jpg Female 54 2114 http://images.proteinatlas.org/47702/108331_A_1_2.jpg Female 62 2182 http://images.proteinatlas.org/47702/108331_A_2_2.jpg Bone marrow Hematopoietic cells not detected negative none none Female 78 3645 http://images.proteinatlas.org/47702/108331_B_4_4.jpg Male 64 3730 http://images.proteinatlas.org/47702/108331_B_5_4.jpg Male 61 3931 http://images.proteinatlas.org/47702/108331_B_6_4.jpg Breast Adipocytes not detected negative none none Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 23 2773 http://images.proteinatlas.org/47702/108331_B_1_4.jpg Female 27 3286 http://images.proteinatlas.org/47702/108331_B_3_4.jpg Female 45 3544 http://images.proteinatlas.org/47702/108331_B_2_4.jpg Bronchus Respiratory epithelial cells not detected negative none none Female 36 1979 http://images.proteinatlas.org/47702/108331_B_5_2.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_6_2.jpg Male 65 3988 http://images.proteinatlas.org/47702/108331_B_4_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected negative none none Male 70 3620 http://images.proteinatlas.org/47702/108331_B_7_7.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_9_7.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Female 28 3618 http://images.proteinatlas.org/47702/108331_B_9_8.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_7_8.jpg Male 37 3731 http://images.proteinatlas.org/47702/108331_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells not detected negative none none Neuronal cells not detected negative none none Neuropil not detected negative none none Male 62 1609 http://images.proteinatlas.org/47702/108331_B_9_5.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_8_5.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_5.jpg Cervix Glandular cells not detected negative none none Squamous epithelial cells not detected negative none none Female 57 2102 http://images.proteinatlas.org/47702/108331_B_7_3.jpg Female 42 2451 http://images.proteinatlas.org/47702/108331_B_8_3.jpg Colon Endothelial cells not detected negative none none Glandular cells not detected negative none none Peripheral nerve/ganglion not detected negative none none Male 47 1857 http://images.proteinatlas.org/47702/108331_A_7_3.jpg Female 79 1985 http://images.proteinatlas.org/47702/108331_A_8_3.jpg Female 62 3753 http://images.proteinatlas.org/47702/108331_A_9_3.jpg Duodenum Glandular cells not detected negative none none Male 35 3219 http://images.proteinatlas.org/47702/108331_A_7_2.jpg Female 62 3515 http://images.proteinatlas.org/47702/108331_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 33 2941 http://images.proteinatlas.org/47702/108331_B_6_3.jpg Female 34 3214 http://images.proteinatlas.org/47702/108331_B_4_3.jpg Female 24 3364 http://images.proteinatlas.org/47702/108331_B_5_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells not detected negative none none Female 48 2355 http://images.proteinatlas.org/47702/108331_B_1_3.jpg Female 65 3998 http://images.proteinatlas.org/47702/108331_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 36 4044 http://images.proteinatlas.org/47702/108331_A_3_6.jpg Male 77 4104 http://images.proteinatlas.org/47702/108331_A_1_6.jpg Esophagus Squamous epithelial cells not detected negative none none Male 60 3221 http://images.proteinatlas.org/47702/108331_B_5_1.jpg Fallopian tube Glandular cells not detected negative none none Female 36 2170 http://images.proteinatlas.org/47702/108331_A_7_7.jpg Female 35 2344 http://images.proteinatlas.org/47702/108331_A_8_7.jpg Female 39 3293 http://images.proteinatlas.org/47702/108331_A_9_7.jpg Gallbladder Glandular cells not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_6_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 65 2465 http://images.proteinatlas.org/47702/108331_B_6_6.jpg Male 54 3643 http://images.proteinatlas.org/47702/108331_B_4_6.jpg Female 64 3732 http://images.proteinatlas.org/47702/108331_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Female 64 3732 http://images.proteinatlas.org/47702/108331_B_7_6.jpg Male 70 3739 http://images.proteinatlas.org/47702/108331_B_8_6.jpg Female 52 3740 http://images.proteinatlas.org/47702/108331_B_9_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules low moderate <25% cytoplasmic/membranous Male 28 1943 http://images.proteinatlas.org/47702/108331_A_8_5.jpg Female 1 2089 http://images.proteinatlas.org/47702/108331_A_7_5.jpg Female 41 2530 http://images.proteinatlas.org/47702/108331_A_9_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected negative none none Male 55 2429 http://images.proteinatlas.org/47702/108331_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/47702/108331_A_9_4.jpg Female 54 3402 http://images.proteinatlas.org/47702/108331_A_7_4.jpg Lung Alveolar cells not detected negative none none Macrophages not detected negative none none Male 65 1470 http://images.proteinatlas.org/47702/108331_A_3_4.jpg Female 67 2208 http://images.proteinatlas.org/47702/108331_A_1_4.jpg Female 49 2268 http://images.proteinatlas.org/47702/108331_A_2_4.jpg Lymph node Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Female 53 3285 http://images.proteinatlas.org/47702/108331_A_9_8.jpg Nasopharynx Respiratory epithelial cells not detected negative none none Male 70 3530 http://images.proteinatlas.org/47702/108331_B_9_2.jpg Male 64 3624 http://images.proteinatlas.org/47702/108331_B_8_2.jpg Oral mucosa Squamous epithelial cells not detected negative none none Female 59 4109 http://images.proteinatlas.org/47702/108331_A_9_1.jpg Female 81 4374 http://images.proteinatlas.org/47702/108331_A_7_1.jpg Ovary Ovarian stroma cells not detected negative none none Female 33 2159 http://images.proteinatlas.org/47702/108331_A_6_7.jpg Female 39 4395 http://images.proteinatlas.org/47702/108331_A_5_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Male 63 1647 http://images.proteinatlas.org/47702/108331_A_2_3.jpg Female 35 2032 http://images.proteinatlas.org/47702/108331_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/47702/108331_A_1_3.jpg Parathyroid gland Glandular cells not detected negative none none Female 86 3176 http://images.proteinatlas.org/47702/108331_A_3_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected negative none none Female 35 1814 http://images.proteinatlas.org/47702/108331_A_2_7.jpg Female 18 2390 http://images.proteinatlas.org/47702/108331_A_3_7.jpg Female 30 2515 http://images.proteinatlas.org/47702/108331_A_1_7.jpg Prostate Glandular cells not detected negative none none Male 60 2098 http://images.proteinatlas.org/47702/108331_A_2_5.jpg Male 48 2472 http://images.proteinatlas.org/47702/108331_A_3_5.jpg Male 76 2932 http://images.proteinatlas.org/47702/108331_A_1_5.jpg Rectum Glandular cells not detected negative none none Female 46 1876 http://images.proteinatlas.org/47702/108331_A_5_3.jpg Male 51 3298 http://images.proteinatlas.org/47702/108331_A_4_3.jpg Salivary gland Glandular cells not detected negative none none Male 63 1845 http://images.proteinatlas.org/47702/108331_B_1_1.jpg Female 33 2048 http://images.proteinatlas.org/47702/108331_B_3_1.jpg Male 62 2367 http://images.proteinatlas.org/47702/108331_B_2_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 67 3914 http://images.proteinatlas.org/47702/108331_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Female 64 1335 http://images.proteinatlas.org/47702/108331_B_2_6.jpg Female 37 1889 http://images.proteinatlas.org/47702/108331_B_1_6.jpg Male 66 2547 http://images.proteinatlas.org/47702/108331_B_3_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected negative none none Langerhans not detected negative none none Melanocytes not detected negative none none Male 62 3610 http://images.proteinatlas.org/47702/108331_B_7_1.jpg Skin 2 Epidermal cells not detected negative none none Female 15 2027 http://images.proteinatlas.org/47702/108331_B_4_8.jpg Female 66 3357 http://images.proteinatlas.org/47702/108331_B_5_8.jpg Small intestine Glandular cells not detected negative none none Male 52 1879 http://images.proteinatlas.org/47702/108331_A_6_2.jpg Male 41 2226 http://images.proteinatlas.org/47702/108331_A_4_2.jpg Female 64 2450 http://images.proteinatlas.org/47702/108331_A_5_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 59 2122 http://images.proteinatlas.org/47702/108331_B_4_7.jpg Female 39 3500 http://images.proteinatlas.org/47702/108331_B_5_7.jpg Male 69 3549 http://images.proteinatlas.org/47702/108331_B_6_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Male 62 1505 http://images.proteinatlas.org/47702/108331_B_2_8.jpg Male 63 3910 http://images.proteinatlas.org/47702/108331_B_3_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Female 26 2744 http://images.proteinatlas.org/47702/108331_B_3_7.jpg Male 63 3987 http://images.proteinatlas.org/47702/108331_B_1_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp not detected negative none none Female 21 1511 http://images.proteinatlas.org/47702/108331_B_8_4.jpg Male 82 1787 http://images.proteinatlas.org/47702/108331_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/47702/108331_B_9_4.jpg Stomach 1 Glandular cells not detected negative none none Male 68 2471 http://images.proteinatlas.org/47702/108331_A_5_1.jpg Stomach 2 Glandular cells not detected negative none none Male 55 1650 http://images.proteinatlas.org/47702/108331_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/47702/108331_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells not detected negative none none Male 46 2435 http://images.proteinatlas.org/47702/108331_A_6_6.jpg Male 56 3355 http://images.proteinatlas.org/47702/108331_A_4_6.jpg Male 25 3627 http://images.proteinatlas.org/47702/108331_A_5_6.jpg Thyroid gland Glandular cells not detected negative none none Male 56 1672 http://images.proteinatlas.org/47702/108331_B_2_5.jpg Female 39 1948 http://images.proteinatlas.org/47702/108331_B_1_5.jpg Female 44 3005 http://images.proteinatlas.org/47702/108331_B_3_5.jpg Tonsil Germinal center cells not detected negative none none Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells not detected negative none none Female 19 2613 http://images.proteinatlas.org/47702/108331_A_4_8.jpg Female 19 3294 http://images.proteinatlas.org/47702/108331_A_6_8.jpg Urinary bladder Urothelial cells not detected negative none none Male 55 1798 http://images.proteinatlas.org/47702/108331_A_6_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/47702/108331_B_3_2.jpg Female 68 1829 http://images.proteinatlas.org/47702/108331_B_1_2.jpg Female 60 3517 http://images.proteinatlas.org/47702/108331_B_2_2.jpg

Breast cancer Tumor cells low not detected Female 41 1458 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_3.jpg Female 55 1775 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108328_A_5_7.jpg http://images.proteinatlas.org/47702/108328_A_5_8.jpg Female 80 1874 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_1.jpg http://images.proteinatlas.org/47702/108328_A_6_2.jpg Female 72 1875 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_7.jpg http://images.proteinatlas.org/47702/108328_A_4_8.jpg Female 61 1910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_1.jpg http://images.proteinatlas.org/47702/108328_A_4_2.jpg Female 73 2115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_1.jpg http://images.proteinatlas.org/47702/108328_A_5_2.jpg Female 83 2160 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_4_5.jpg http://images.proteinatlas.org/47702/108328_A_4_6.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_3.jpg http://images.proteinatlas.org/47702/108328_A_5_4.jpg Female 51 2565 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_7.jpg http://images.proteinatlas.org/47702/108328_A_6_8.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_3.jpg http://images.proteinatlas.org/47702/108328_A_6_4.jpg Female 58 3546 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_6_6.jpg Female 43 4193 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_5_5.jpg http://images.proteinatlas.org/47702/108328_A_5_6.jpg Carcinoid Tumor cells not detected Female 54 2088 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_1.jpg http://images.proteinatlas.org/47702/108329_A_1_2.jpg Male 41 2618 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_7.jpg http://images.proteinatlas.org/47702/108329_A_1_8.jpg Female 52 3043 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_3.jpg http://images.proteinatlas.org/47702/108329_A_1_4.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_1_5.jpg http://images.proteinatlas.org/47702/108329_A_1_6.jpg Cervical cancer Tumor cells not detected Female 55 470 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_5.jpg http://images.proteinatlas.org/47702/108328_B_5_6.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_3.jpg http://images.proteinatlas.org/47702/108328_B_6_4.jpg Female 46 3400 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_7.jpg http://images.proteinatlas.org/47702/108328_B_5_8.jpg Female 46 4219 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_1.jpg http://images.proteinatlas.org/47702/108328_B_5_2.jpg Female 36 4221 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_6_1.jpg http://images.proteinatlas.org/47702/108328_B_6_2.jpg Female 39 4223 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_5.jpg http://images.proteinatlas.org/47702/108328_B_4_6.jpg Female 52 4224 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_7.jpg http://images.proteinatlas.org/47702/108328_B_4_8.jpg Female 44 4225 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_4_4.jpg Female 70 4226 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_5_3.jpg http://images.proteinatlas.org/47702/108328_B_5_4.jpg Colorectal cancer Tumor cells not detected Male 87 1811 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_5.jpg http://images.proteinatlas.org/47702/108328_A_2_6.jpg Male 71 1898 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_3.jpg http://images.proteinatlas.org/47702/108328_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_5.jpg http://images.proteinatlas.org/47702/108328_A_1_6.jpg Male 83 1962 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_3.jpg http://images.proteinatlas.org/47702/108328_A_1_4.jpg Female 67 2616 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_7.jpg http://images.proteinatlas.org/47702/108328_A_2_8.jpg Male 77 2931 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_1.jpg http://images.proteinatlas.org/47702/108328_A_1_2.jpg Male 83 2947 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_7.jpg http://images.proteinatlas.org/47702/108328_A_3_8.jpg Male 72 3074 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_5.jpg http://images.proteinatlas.org/47702/108328_A_3_6.jpg Female 67 4089 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_1.jpg http://images.proteinatlas.org/47702/108328_A_3_2.jpg Female 86 4094 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_3_3.jpg http://images.proteinatlas.org/47702/108328_A_3_4.jpg Female 43 4382 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_1_7.jpg http://images.proteinatlas.org/47702/108328_A_1_8.jpg Female 48 4606 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_2_1.jpg http://images.proteinatlas.org/47702/108328_A_2_2.jpg Endometrial cancer Tumor cells not detected Female 56 309 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_1.jpg http://images.proteinatlas.org/47702/108328_B_8_2.jpg Female 68 1128 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_5.jpg http://images.proteinatlas.org/47702/108328_B_7_6.jpg Female 70 2118 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_1.jpg http://images.proteinatlas.org/47702/108328_B_7_2.jpg Female 75 2173 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_7.jpg http://images.proteinatlas.org/47702/108328_B_8_8.jpg Female 79 2339 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_1.jpg http://images.proteinatlas.org/47702/108328_B_9_2.jpg Female 81 2607 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_5.jpg http://images.proteinatlas.org/47702/108328_B_8_6.jpg Female 58 2621 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_3.jpg http://images.proteinatlas.org/47702/108328_B_7_4.jpg Female 32 3036 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_5.jpg http://images.proteinatlas.org/47702/108328_B_9_6.jpg Female 51 3481 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_8_3.jpg http://images.proteinatlas.org/47702/108328_B_8_4.jpg Female 80 3540 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_7.jpg http://images.proteinatlas.org/47702/108328_B_9_8.jpg Female 70 3999 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_9_3.jpg http://images.proteinatlas.org/47702/108328_B_9_4.jpg Female 62 4201 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_7_7.jpg http://images.proteinatlas.org/47702/108328_B_7_8.jpg Glioma Tumor cells not detected Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_2.jpg Female 39 1613 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_3.jpg http://images.proteinatlas.org/47702/108329_A_4_4.jpg Male 60 1642 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_7.jpg http://images.proteinatlas.org/47702/108329_A_6_8.jpg Female 59 1645 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_5.jpg http://images.proteinatlas.org/47702/108329_A_6_6.jpg Male 47 2790 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_7.jpg http://images.proteinatlas.org/47702/108329_A_4_8.jpg Female 57 2843 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_3.jpg http://images.proteinatlas.org/47702/108329_A_6_4.jpg Female 1 3023 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_3.jpg http://images.proteinatlas.org/47702/108329_A_5_4.jpg Male 69 3064 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_5.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_1.jpg http://images.proteinatlas.org/47702/108329_A_5_2.jpg Male 53 3203 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_5_7.jpg http://images.proteinatlas.org/47702/108329_A_5_8.jpg Male 56 3226 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_6_1.jpg http://images.proteinatlas.org/47702/108329_A_6_2.jpg Male 65 3365 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_4_5.jpg http://images.proteinatlas.org/47702/108329_A_4_6.jpg Head and neck cancer Tumor cells not detected Male 62 1743 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_3.jpg Male 66 2547 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_5.jpg http://images.proteinatlas.org/47702/108329_A_2_6.jpg Male 81 3360 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_2_1.jpg http://images.proteinatlas.org/47702/108329_A_2_2.jpg Liver cancer Tumor cells not detected Female 53 983 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_3.jpg http://images.proteinatlas.org/47702/108330_B_8_4.jpg Female 58 2177 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_1.jpg http://images.proteinatlas.org/47702/108330_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_1.jpg http://images.proteinatlas.org/47702/108330_B_7_2.jpg Female 52 2399 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_7.jpg http://images.proteinatlas.org/47702/108330_B_8_8.jpg Male 72 2556 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_3.jpg http://images.proteinatlas.org/47702/108330_B_9_4.jpg Male 47 2652 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_8_5.jpg http://images.proteinatlas.org/47702/108330_B_8_6.jpg Female 73 2766 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_7.jpg http://images.proteinatlas.org/47702/108330_B_7_8.jpg Male 70 3324 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_1.jpg http://images.proteinatlas.org/47702/108330_B_9_2.jpg Male 67 3334 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_3.jpg http://images.proteinatlas.org/47702/108330_B_7_4.jpg Male 67 3477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_7.jpg http://images.proteinatlas.org/47702/108330_B_9_8.jpg Male 59 3625 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_7_5.jpg http://images.proteinatlas.org/47702/108330_B_7_6.jpg Female 77 3841 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_9_5.jpg http://images.proteinatlas.org/47702/108330_B_9_6.jpg Lung cancer Tumor cells not detected Female 76 448 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_5.jpg http://images.proteinatlas.org/47702/108329_B_2_6.jpg Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_7.jpg http://images.proteinatlas.org/47702/108329_B_1_8.jpg Male 64 1847 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_5.jpg http://images.proteinatlas.org/47702/108329_B_3_6.jpg Male 73 1937 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_1.jpg http://images.proteinatlas.org/47702/108329_B_1_2.jpg Female 54 2393 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_3.jpg http://images.proteinatlas.org/47702/108329_B_1_4.jpg Male 65 2567 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_7.jpg http://images.proteinatlas.org/47702/108329_B_2_8.jpg Male 74 2779 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_1_5.jpg http://images.proteinatlas.org/47702/108329_B_1_6.jpg Male 49 3003 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_1.jpg http://images.proteinatlas.org/47702/108329_B_2_2.jpg Male 66 3185 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_3_7.jpg http://images.proteinatlas.org/47702/108329_B_3_8.jpg Female 70 3986 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_2_3.jpg http://images.proteinatlas.org/47702/108329_B_2_4.jpg Lymphoma Tumor cells not detected Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_7.jpg http://images.proteinatlas.org/47702/108329_A_7_8.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_1.jpg http://images.proteinatlas.org/47702/108329_A_7_2.jpg Male 67 1719 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_5.jpg http://images.proteinatlas.org/47702/108329_A_8_6.jpg Female 19 1734 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_7.jpg http://images.proteinatlas.org/47702/108329_A_8_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_1.jpg http://images.proteinatlas.org/47702/108329_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_5.jpg http://images.proteinatlas.org/47702/108329_A_9_6.jpg Female 71 3012 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_7.jpg http://images.proteinatlas.org/47702/108329_A_9_8.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_3.jpg http://images.proteinatlas.org/47702/108329_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_3.jpg http://images.proteinatlas.org/47702/108329_A_7_4.jpg Male 13 3166 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_8_1.jpg http://images.proteinatlas.org/47702/108329_A_8_2.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_9_3.jpg http://images.proteinatlas.org/47702/108329_A_9_4.jpg Female 53 3285 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_7_5.jpg http://images.proteinatlas.org/47702/108329_A_7_6.jpg Melanoma Tumor cells not detected Female 81 21 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_7.jpg Male 88 111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_6.jpg Male 64 2317 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_7.jpg http://images.proteinatlas.org/47702/108329_B_6_8.jpg Male 41 2383 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_3.jpg http://images.proteinatlas.org/47702/108329_B_4_4.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_4_1.jpg http://images.proteinatlas.org/47702/108329_B_4_2.jpg Female 82 3060 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_1.jpg http://images.proteinatlas.org/47702/108329_B_6_2.jpg Female 56 3192 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_5.jpg http://images.proteinatlas.org/47702/108329_B_5_6.jpg Female 72 3611 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_3.jpg http://images.proteinatlas.org/47702/108329_B_5_4.jpg Female 91 3887 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_5_1.jpg http://images.proteinatlas.org/47702/108329_B_5_2.jpg Female 52 4018 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_3.jpg http://images.proteinatlas.org/47702/108329_B_6_4.jpg Male 84 4028 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_6_5.jpg Ovarian cancer Tumor cells not detected Female 73 1844 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_1.jpg http://images.proteinatlas.org/47702/108328_B_3_2.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_5.jpg http://images.proteinatlas.org/47702/108328_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_1.jpg http://images.proteinatlas.org/47702/108328_B_2_2.jpg Female 54 2114 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_7.jpg http://images.proteinatlas.org/47702/108328_B_1_8.jpg Female 42 2218 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_3.jpg http://images.proteinatlas.org/47702/108328_B_3_4.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_1.jpg http://images.proteinatlas.org/47702/108328_B_1_2.jpg Female 69 2391 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_5.jpg http://images.proteinatlas.org/47702/108328_B_1_6.jpg Female 62 2568 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_3_7.jpg http://images.proteinatlas.org/47702/108328_B_3_8.jpg Female 58 2724 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_1_3.jpg http://images.proteinatlas.org/47702/108328_B_1_4.jpg Female 56 3115 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_3.jpg http://images.proteinatlas.org/47702/108328_B_2_4.jpg Female 70 4361 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_7.jpg http://images.proteinatlas.org/47702/108328_B_2_8.jpg Female 61 4369 Not detected Negative None none http://images.proteinatlas.org/47702/108328_B_2_5.jpg http://images.proteinatlas.org/47702/108328_B_2_6.jpg Pancreatic cancer Tumor cells not detected Female 61 3614 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_3.jpg http://images.proteinatlas.org/47702/108330_B_6_4.jpg Female 73 3719 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_1.jpg http://images.proteinatlas.org/47702/108330_B_4_2.jpg Male 63 3851 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_3.jpg http://images.proteinatlas.org/47702/108330_B_4_4.jpg http://images.proteinatlas.org/47702/108330_B_5_5.jpg http://images.proteinatlas.org/47702/108330_B_5_6.jpg Male 68 3892 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_7.jpg http://images.proteinatlas.org/47702/108330_B_4_8.jpg Male 65 4082 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_3.jpg http://images.proteinatlas.org/47702/108330_B_5_4.jpg Male 63 4139 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_4_5.jpg http://images.proteinatlas.org/47702/108330_B_4_6.jpg Male 48 4142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_7.jpg http://images.proteinatlas.org/47702/108330_B_5_8.jpg Male 46 4144 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_5_1.jpg http://images.proteinatlas.org/47702/108330_B_5_2.jpg Male 78 4149 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_5.jpg http://images.proteinatlas.org/47702/108330_B_6_6.jpg Male 72 4154 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_6_7.jpg http://images.proteinatlas.org/47702/108330_B_6_8.jpg Prostate cancer Tumor cells not detected Male 63 3455 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_1.jpg http://images.proteinatlas.org/47702/108328_A_8_2.jpg Male 63 3910 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_7.jpg http://images.proteinatlas.org/47702/108328_A_9_8.jpg Male 68 3984 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_3.jpg http://images.proteinatlas.org/47702/108328_A_8_4.jpg Male 71 4163 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_5.jpg http://images.proteinatlas.org/47702/108328_A_8_6.jpg Male 72 4337 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_7.jpg http://images.proteinatlas.org/47702/108328_A_7_8.jpg Male 55 4338 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_8_8.jpg Male 64 4344 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_1.jpg http://images.proteinatlas.org/47702/108328_A_9_2.jpg Male 68 4350 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_5.jpg http://images.proteinatlas.org/47702/108328_A_7_6.jpg Male 63 4363 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_3.jpg http://images.proteinatlas.org/47702/108328_A_7_4.jpg Male 71 4365 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_7_1.jpg http://images.proteinatlas.org/47702/108328_A_7_2.jpg Male 55 4524 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_3.jpg http://images.proteinatlas.org/47702/108328_A_9_4.jpg Male 60 4529 Not detected Negative None none http://images.proteinatlas.org/47702/108328_A_9_5.jpg http://images.proteinatlas.org/47702/108328_A_9_6.jpg Renal cancer Tumor cells not detected Male 77 1831 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_5.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_3.jpg http://images.proteinatlas.org/47702/108330_A_9_4.jpg Male 63 1969 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_1.jpg http://images.proteinatlas.org/47702/108330_A_9_2.jpg Male 59 2176 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_7.jpg http://images.proteinatlas.org/47702/108330_A_7_8.jpg Female 64 2210 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_5.jpg http://images.proteinatlas.org/47702/108330_A_9_6.jpg Male 59 2261 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_1.jpg http://images.proteinatlas.org/47702/108330_A_8_2.jpg Male 80 2477 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_3.jpg http://images.proteinatlas.org/47702/108330_A_8_4.jpg Female 72 2545 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_1.jpg http://images.proteinatlas.org/47702/108330_A_7_2.jpg Female 52 2564 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_3.jpg Male 63 3156 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_9_7.jpg http://images.proteinatlas.org/47702/108330_A_9_8.jpg Female 59 3541 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_7_5.jpg http://images.proteinatlas.org/47702/108330_A_7_6.jpg Female 63 3616 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_8_7.jpg http://images.proteinatlas.org/47702/108330_A_8_8.jpg Skin cancer Tumor cells not detected Male 71 56 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_7.jpg http://images.proteinatlas.org/47702/108329_B_9_8.jpg Female 66 1075 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_2.jpg Female 59 1219 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_6.jpg Male 72 1663 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_5.jpg http://images.proteinatlas.org/47702/108329_B_7_6.jpg Female 84 1983 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_3.jpg http://images.proteinatlas.org/47702/108329_B_8_4.jpg Female 85 2013 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_5.jpg http://images.proteinatlas.org/47702/108329_B_9_6.jpg Male 75 2111 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_3.jpg http://images.proteinatlas.org/47702/108329_B_7_4.jpg Male 73 2808 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_9_3.jpg Female 44 3261 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_8_8.jpg Male 71 3280 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_7.jpg http://images.proteinatlas.org/47702/108329_B_7_8.jpg Female 65 3726 Not detected Negative None none http://images.proteinatlas.org/47702/108329_B_7_2.jpg Stomach cancer Tumor cells not detected Female 64 1994 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_7.jpg http://images.proteinatlas.org/47702/108330_B_1_8.jpg Male 76 2066 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_3.jpg http://images.proteinatlas.org/47702/108330_B_1_4.jpg Male 62 2142 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_7.jpg http://images.proteinatlas.org/47702/108330_B_2_8.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_6.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_5.jpg http://images.proteinatlas.org/47702/108330_B_3_6.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_2_3.jpg http://images.proteinatlas.org/47702/108330_B_2_4.jpg Male 48 3044 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_3_3.jpg http://images.proteinatlas.org/47702/108330_B_3_4.jpg Female 60 3526 Not detected Negative None none http://images.proteinatlas.org/47702/108330_B_1_5.jpg http://images.proteinatlas.org/47702/108330_B_1_6.jpg Testis cancer Tumor cells low not detected Male 41 1700 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_3_5.jpg http://images.proteinatlas.org/47702/108330_A_3_6.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_3.jpg http://images.proteinatlas.org/47702/108330_A_2_4.jpg Male 26 2071 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_3.jpg http://images.proteinatlas.org/47702/108330_A_1_4.jpg Male 46 2435 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_5.jpg Male 65 2558 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_7.jpg http://images.proteinatlas.org/47702/108330_A_2_8.jpg Male 28 3108 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_1.jpg http://images.proteinatlas.org/47702/108330_A_2_2.jpg Male 25 3627 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_1_1.jpg http://images.proteinatlas.org/47702/108330_A_1_2.jpg Male 49 3751 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_2_5.jpg http://images.proteinatlas.org/47702/108330_A_2_6.jpg Male 45 3893 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_1_7.jpg http://images.proteinatlas.org/47702/108330_A_1_8.jpg Thyroid cancer Tumor cells not detected Female 72 625 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_5.jpg http://images.proteinatlas.org/47702/108329_A_3_6.jpg Male 52 932 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_1.jpg http://images.proteinatlas.org/47702/108329_A_3_2.jpg Female 59 3037 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_7.jpg Male 75 3107 Not detected Negative None none http://images.proteinatlas.org/47702/108329_A_3_3.jpg http://images.proteinatlas.org/47702/108329_A_3_4.jpg Urothelial cancer Tumor cells low not detected Male 67 810 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_7.jpg http://images.proteinatlas.org/47702/108330_A_5_8.jpg Male 50 1717 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/47702/108330_A_5_5.jpg http://images.proteinatlas.org/47702/108330_A_5_6.jpg Female 85 1871 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_1.jpg http://images.proteinatlas.org/47702/108330_A_6_2.jpg Male 78 2469 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_3.jpg http://images.proteinatlas.org/47702/108330_A_4_4.jpg Male 89 2704 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_1.jpg Male 64 2839 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_7.jpg http://images.proteinatlas.org/47702/108330_A_4_8.jpg Female 70 3079 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_5_3.jpg http://images.proteinatlas.org/47702/108330_A_5_4.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_1.jpg http://images.proteinatlas.org/47702/108330_A_4_2.jpg Female 63 3516 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_3.jpg http://images.proteinatlas.org/47702/108330_A_6_4.jpg Female 60 3517 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_4_5.jpg http://images.proteinatlas.org/47702/108330_A_4_6.jpg Female 63 3780 Not detected Negative None none http://images.proteinatlas.org/47702/108330_A_6_8.jpg uncertain http://v21.proteinatlas.org/images_western_blot/47702_medium.jpg approved http://v21.proteinatlas.org/images_protein_array/47702_medium.png IGKV4-1 B3 IGKV41 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi RPMI-8226 SH-SY5Y U-266/70 Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in all Plasma cells Detected in some Plasma cells - Humoral immune response IGLC3 IGLC Intracellular, Secreted (different isoforms)

supported Liver http://images.proteinatlas.org/16533/36341_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/16533/36341_A_8_3_rna_selected.jpg Kidney http://images.proteinatlas.org/16533/36341_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/16533/36341_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/16533/36341_A_9_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/16533/36341_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in all Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 Detected in many RPMI-8226 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in all B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in all B-cells Plasma cells T-cells Detected in many Plasma cells - Humoral immune response

supported No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/50/ihc_selected.jpg Adipose tissue Adipocytes high strong >75% cytoplasmic/membranous Female 45 1447 http://images.proteinatlas.org/50/811_B_2_8.jpg Female 44 1452 http://images.proteinatlas.org/50/811_B_1_8.jpg Male 65 1470 http://images.proteinatlas.org/50/811_B_3_8.jpg Male 63 1647 http://images.proteinatlas.org/50/811_B_1_7.jpg Male 52 1879 http://images.proteinatlas.org/50/811_B_2_7.jpg Adrenal gland Glandular cells high strong >75% cytoplasmic/membranous Male 53 1653 http://images.proteinatlas.org/50/811_B_4_5.jpg Female 60 1721 http://images.proteinatlas.org/50/811_B_6_5.jpg Male 57 1725 http://images.proteinatlas.org/50/811_B_5_5.jpg Appendix Glandular cells high strong >75% cytoplasmic/membranous Lymphoid tissue not detected negative none none Male 25 4 http://images.proteinatlas.org/50/811_A_2_2.jpg Female 19 60 http://images.proteinatlas.org/50/811_A_3_2.jpg Female 34 512 http://images.proteinatlas.org/50/811_A_1_2.jpg Breast Adipocytes high strong >75% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Myoepithelial cells not detected negative none none Female 45 1447 http://images.proteinatlas.org/50/811_B_2_4.jpg Female 44 1452 http://images.proteinatlas.org/50/811_B_3_4.jpg Bronchus Respiratory epithelial cells high strong >75% cytoplasmic/membranous Female 57 1932 http://images.proteinatlas.org/50/811_B_6_2.jpg Caudate Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/50/811_B_7_7.jpg Female 54 2523 http://images.proteinatlas.org/50/811_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/50/811_B_9_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer low moderate <25% cytoplasmic/membranous Purkinje cells high strong >75% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/50/811_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/50/811_B_8_8.jpg Female 19 2524 http://images.proteinatlas.org/50/811_B_9_8.jpg Cerebral cortex Endothelial cells medium moderate 75%-25% cytoplasmic/membranous Glial cells not detected negative none none Neuronal cells medium moderate 75%-25% cytoplasmic/membranous Neuropil low weak >75% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/50/811_B_7_5.jpg Female 54 2523 http://images.proteinatlas.org/50/811_B_8_5.jpg Female 19 2524 http://images.proteinatlas.org/50/811_B_9_5.jpg Cervix Glandular cells high strong >75% cytoplasmic/membranous Squamous epithelial cells medium moderate 75%-25% cytoplasmic/membranous Female 82 1401 http://images.proteinatlas.org/50/811_B_7_3.jpg Female 53 1681 http://images.proteinatlas.org/50/811_B_8_3.jpg Colon Endothelial cells medium moderate >75% cytoplasmic/membranous Glandular cells high strong 75%-25% cytoplasmic/membranous Peripheral nerve/ganglion not detected negative none none Male 1 177 http://images.proteinatlas.org/50/811_A_7_3.jpg Female 55 634 http://images.proteinatlas.org/50/811_A_9_3.jpg Male 54 966 http://images.proteinatlas.org/50/811_A_8_3.jpg Duodenum Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 48 75 http://images.proteinatlas.org/50/811_A_9_2.jpg Female 77 195 http://images.proteinatlas.org/50/811_A_7_2.jpg Male 70 582 http://images.proteinatlas.org/50/811_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected negative none none Glandular cells high strong >75% cytoplasmic/membranous Female 36 1481 http://images.proteinatlas.org/50/811_B_6_3.jpg Female 35 1728 http://images.proteinatlas.org/50/811_B_4_3.jpg Female 36 1733 http://images.proteinatlas.org/50/811_B_5_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells high strong 75%-25% cytoplasmic/membranous Female 82 1401 http://images.proteinatlas.org/50/811_B_3_3.jpg Female 52 1476 http://images.proteinatlas.org/50/811_B_2_3.jpg Female 83 1750 http://images.proteinatlas.org/50/811_B_1_3.jpg Epididymis Glandular cells high strong >75% cytoplasmic/membranous Male 37 284 http://images.proteinatlas.org/50/811_A_3_6.jpg Male 52 522 http://images.proteinatlas.org/50/811_A_1_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 65 1729 http://images.proteinatlas.org/50/811_B_4_1.jpg Female 61 1924 http://images.proteinatlas.org/50/811_B_6_1.jpg Male 70 1945 http://images.proteinatlas.org/50/811_B_5_1.jpg Fallopian tube Glandular cells high strong >75% cytoplasmic/membranous Female 32 622 http://images.proteinatlas.org/50/811_A_7_7.jpg Female 38 895 http://images.proteinatlas.org/50/811_A_8_7.jpg Female 41 1019 http://images.proteinatlas.org/50/811_A_9_7.jpg Gallbladder Glandular cells high strong >75% cytoplasmic/membranous Male 73 64 http://images.proteinatlas.org/50/811_A_5_4.jpg Female 44 112 http://images.proteinatlas.org/50/811_A_4_4.jpg Female 76 329 http://images.proteinatlas.org/50/811_A_6_4.jpg Heart muscle Cardiomyocytes medium moderate >75% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/50/811_B_4_6.jpg Female 54 2523 http://images.proteinatlas.org/50/811_B_5_6.jpg Female 19 2524 http://images.proteinatlas.org/50/811_B_6_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells low moderate <25% cytoplasmic/membranous Female 54 2523 http://images.proteinatlas.org/50/811_B_8_6.jpg Female 19 2524 http://images.proteinatlas.org/50/811_B_9_6.jpg Kidney Cells in glomeruli medium moderate 75%-25% cytoplasmic/membranous Cells in tubules high strong 75%-25% cytoplasmic/membranous Male 61 443 http://images.proteinatlas.org/50/811_A_9_5.jpg Male 36 924 http://images.proteinatlas.org/50/811_A_8_5.jpg Female 52 1263 http://images.proteinatlas.org/50/811_A_7_5.jpg Liver Cholangiocytes medium moderate 75%-25% cytoplasmic/membranous Hepatocytes high strong >75% cytoplasmic/membranous Female 30 162 http://images.proteinatlas.org/50/811_A_9_4.jpg Female 79 516 http://images.proteinatlas.org/50/811_A_8_4.jpg Male 35 548 http://images.proteinatlas.org/50/811_A_7_4.jpg Lung Alveolar cells high strong 75%-25% cytoplasmic/membranous Macrophages high strong >75% cytoplasmic/membranous Male 73 218 http://images.proteinatlas.org/50/811_A_3_4.jpg Female 75 496 http://images.proteinatlas.org/50/811_A_1_4.jpg Female 61 705 http://images.proteinatlas.org/50/811_A_2_4.jpg Lymph node Germinal center cells medium moderate 75%-25% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Male 67 89 http://images.proteinatlas.org/50/811_A_9_8.jpg Female 35 285 http://images.proteinatlas.org/50/811_A_8_8.jpg Female 53 1004 http://images.proteinatlas.org/50/811_A_7_8.jpg Nasopharynx Respiratory epithelial cells high strong >75% cytoplasmic/membranous Male 13 2249 http://images.proteinatlas.org/50/811_B_7_2.jpg Female 78 2630 http://images.proteinatlas.org/50/811_B_8_2.jpg Oral mucosa Squamous epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 14 25 http://images.proteinatlas.org/50/811_A_8_1.jpg Female 79 340 http://images.proteinatlas.org/50/811_A_7_1.jpg Male 54 760 http://images.proteinatlas.org/50/811_A_9_1.jpg Ovary Follicle cells not detected negative none none Ovarian stroma cells medium moderate 75%-25% cytoplasmic/membranous Female 78 251 http://images.proteinatlas.org/50/811_A_5_7.jpg Female 32 622 http://images.proteinatlas.org/50/811_A_6_7.jpg Female 63 745 http://images.proteinatlas.org/50/811_A_4_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Male 73 64 http://images.proteinatlas.org/50/811_A_1_3.jpg Female 73 374 http://images.proteinatlas.org/50/811_A_2_3.jpg Male 59 969 http://images.proteinatlas.org/50/811_A_3_3.jpg Parathyroid gland Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 54 11 http://images.proteinatlas.org/50/811_A_1_8.jpg Female 71 43 http://images.proteinatlas.org/50/811_A_3_8.jpg Male 71 84 http://images.proteinatlas.org/50/811_A_2_8.jpg Placenta Decidual cells low weak 75%-25% cytoplasmic/membranous Trophoblastic cells high strong >75% cytoplasmic/membranous Female 31 337 http://images.proteinatlas.org/50/811_A_1_7.jpg Female 24 686 http://images.proteinatlas.org/50/811_A_3_7.jpg Female 40 735 http://images.proteinatlas.org/50/811_A_2_7.jpg Prostate Glandular cells high strong 75%-25% cytoplasmic/membranous Male 65 78 http://images.proteinatlas.org/50/811_A_2_5.jpg Male 68 613 http://images.proteinatlas.org/50/811_A_3_5.jpg Rectum Glandular cells high strong >75% cytoplasmic/membranous Male 65 62 http://images.proteinatlas.org/50/811_A_5_3.jpg Male 77 222 http://images.proteinatlas.org/50/811_A_6_3.jpg Female 60 1087 http://images.proteinatlas.org/50/811_A_4_3.jpg Salivary gland Glandular cells not detected negative none none Male 62 1505 http://images.proteinatlas.org/50/811_B_1_1.jpg Male 54 1682 http://images.proteinatlas.org/50/811_B_2_1.jpg Female 55 1973 http://images.proteinatlas.org/50/811_B_3_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 63 472 http://images.proteinatlas.org/50/811_A_9_6.jpg Male 69 525 http://images.proteinatlas.org/50/811_A_7_6.jpg Male 60 756 http://images.proteinatlas.org/50/811_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 62 1505 http://images.proteinatlas.org/50/811_B_1_6.jpg Male 71 1711 http://images.proteinatlas.org/50/811_B_2_6.jpg Female 37 1889 http://images.proteinatlas.org/50/811_B_3_6.jpg Skin 2 Epidermal cells high strong >75% cytoplasmic/membranous Male 61 456 http://images.proteinatlas.org/50/811_B_6_8.jpg Female 86 1813 http://images.proteinatlas.org/50/811_B_4_8.jpg Female 46 1876 http://images.proteinatlas.org/50/811_B_5_8.jpg Small intestine Glandular cells high strong >75% cytoplasmic/membranous Female 37 29 http://images.proteinatlas.org/50/811_A_6_2.jpg Female 69 133 http://images.proteinatlas.org/50/811_A_5_2.jpg Male 1 493 http://images.proteinatlas.org/50/811_A_4_2.jpg Smooth muscle Smooth muscle cells high strong >75% cytoplasmic/membranous Male 63 1647 http://images.proteinatlas.org/50/811_B_5_7.jpg Female 45 1695 http://images.proteinatlas.org/50/811_B_6_7.jpg Soft tissue 1 Fibroblasts high strong >75% cytoplasmic/membranous Female 45 1447 http://images.proteinatlas.org/50/811_B_2_8.jpg Female 44 1452 http://images.proteinatlas.org/50/811_B_1_8.jpg Male 65 1470 http://images.proteinatlas.org/50/811_B_3_8.jpg Soft tissue 2 Fibroblasts high strong >75% cytoplasmic/membranous Peripheral nerve low weak >75% cytoplasmic/membranous Male 63 1647 http://images.proteinatlas.org/50/811_B_1_7.jpg Male 52 1879 http://images.proteinatlas.org/50/811_B_2_7.jpg Spleen Cells in red pulp high strong >75% cytoplasmic/membranous Cells in white pulp high strong 75%-25% cytoplasmic/membranous Male 18 1375 http://images.proteinatlas.org/50/811_B_8_4.jpg Female 21 1511 http://images.proteinatlas.org/50/811_B_7_4.jpg Male 72 1714 http://images.proteinatlas.org/50/811_B_9_4.jpg Stomach 1 Glandular cells not detected negative none none Male 72 301 http://images.proteinatlas.org/50/811_A_6_1.jpg Female 75 328 http://images.proteinatlas.org/50/811_A_4_1.jpg Male 47 1266 http://images.proteinatlas.org/50/811_A_5_1.jpg Stomach 2 Glandular cells not detected negative none none Male 84 139 http://images.proteinatlas.org/50/811_A_1_1.jpg Female 43 148 http://images.proteinatlas.org/50/811_A_2_1.jpg Male 58 253 http://images.proteinatlas.org/50/811_A_3_1.jpg Testis Cells in seminiferous ducts high strong 75%-25% cytoplasmic/membranous Leydig cells high strong >75% cytoplasmic/membranous Male 38 305 http://images.proteinatlas.org/50/811_A_6_6.jpg Male 24 1171 http://images.proteinatlas.org/50/811_A_5_6.jpg Male 57 1180 http://images.proteinatlas.org/50/811_A_4_6.jpg Thyroid gland Glandular cells high strong >75% cytoplasmic/membranous Male 34 1430 http://images.proteinatlas.org/50/811_B_1_5.jpg Male 76 1436 http://images.proteinatlas.org/50/811_B_2_5.jpg Female 55 1439 http://images.proteinatlas.org/50/811_B_3_5.jpg Tonsil Germinal center cells high strong 75%-25% cytoplasmic/membranous Non-germinal center cells low moderate <25% cytoplasmic/membranous Squamous epithelial cells high strong 75%-25% cytoplasmic/membranous Female 3 678 http://images.proteinatlas.org/50/811_A_5_8.jpg Female 41 786 http://images.proteinatlas.org/50/811_A_4_8.jpg Urinary bladder Urothelial cells high strong >75% cytoplasmic/membranous Male 48 326 http://images.proteinatlas.org/50/811_A_6_5.jpg Vagina Squamous epithelial cells medium moderate 75%-25% cytoplasmic/membranous Female 34 1751 http://images.proteinatlas.org/50/811_B_1_2.jpg Female 68 1829 http://images.proteinatlas.org/50/811_B_3_2.jpg

Breast cancer Tumor cells high medium low not detected Female 72 103 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_5_7.jpg http://images.proteinatlas.org/50/809_A_5_8.jpg Female 91 108 Not detected Negative None none http://images.proteinatlas.org/50/809_A_4_1.jpg http://images.proteinatlas.org/50/809_A_4_2.jpg Female 68 159 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_4_3.jpg Female 68 261 Not detected Negative None none http://images.proteinatlas.org/50/809_A_5_1.jpg http://images.proteinatlas.org/50/809_A_5_2.jpg Female 50 315 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_5_3.jpg http://images.proteinatlas.org/50/809_A_5_4.jpg Female 55 319 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_5_5.jpg http://images.proteinatlas.org/50/809_A_5_6.jpg Female 50 558 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_4_7.jpg http://images.proteinatlas.org/50/809_A_4_8.jpg Female 53 858 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_6_3.jpg http://images.proteinatlas.org/50/809_A_6_4.jpg Female 57 1044 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_4_5.jpg http://images.proteinatlas.org/50/809_A_4_6.jpg Carcinoid Tumor cells medium low not detected Female 76 227 Not detected Negative None none http://images.proteinatlas.org/50/810_A_1_3.jpg http://images.proteinatlas.org/50/810_A_1_4.jpg Male 63 604 Not detected Negative None none http://images.proteinatlas.org/50/810_A_1_5.jpg http://images.proteinatlas.org/50/810_A_1_6.jpg Male 60 997 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_1_1.jpg http://images.proteinatlas.org/50/810_A_1_2.jpg Male 55 1092 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_1_7.jpg http://images.proteinatlas.org/50/810_A_1_8.jpg Cervical cancer Tumor cells high medium low not detected Female 34 245 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_5_7.jpg http://images.proteinatlas.org/50/809_B_5_8.jpg Female 41 361 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_6_3.jpg http://images.proteinatlas.org/50/809_B_6_4.jpg Female 41 507 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_4_1.jpg http://images.proteinatlas.org/50/809_B_4_2.jpg Female 57 642 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_4_7.jpg http://images.proteinatlas.org/50/809_B_4_8.jpg Female 34 828 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_4_3.jpg http://images.proteinatlas.org/50/809_B_4_4.jpg Female 54 926 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_6_7.jpg http://images.proteinatlas.org/50/809_B_6_8.jpg Female 54 947 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_6_5.jpg http://images.proteinatlas.org/50/809_B_6_6.jpg Female 38 1071 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_5_5.jpg http://images.proteinatlas.org/50/809_B_5_6.jpg Female 31 1131 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_5_1.jpg http://images.proteinatlas.org/50/809_B_5_2.jpg Female 41 1137 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_6_1.jpg http://images.proteinatlas.org/50/809_B_6_2.jpg Female 49 1187 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_4_5.jpg http://images.proteinatlas.org/50/809_B_4_6.jpg Female 41 1267 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_5_3.jpg http://images.proteinatlas.org/50/809_B_5_4.jpg Colorectal cancer Tumor cells high medium low not detected Female 81 55 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_3_7.jpg http://images.proteinatlas.org/50/809_A_3_8.jpg Female 70 157 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_1_3.jpg Male 76 192 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_2_3.jpg http://images.proteinatlas.org/50/809_A_2_4.jpg Male 65 257 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_2_7.jpg http://images.proteinatlas.org/50/809_A_2_8.jpg Female 67 415 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_1_5.jpg http://images.proteinatlas.org/50/809_A_1_6.jpg Female 65 416 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_1_7.jpg http://images.proteinatlas.org/50/809_A_1_8.jpg Female 86 418 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_3_1.jpg http://images.proteinatlas.org/50/809_A_3_2.jpg Female 78 442 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_3_3.jpg http://images.proteinatlas.org/50/809_A_3_4.jpg Female 76 520 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_2_1.jpg http://images.proteinatlas.org/50/809_A_2_2.jpg Male 49 1121 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_1_1.jpg http://images.proteinatlas.org/50/809_A_1_2.jpg Female 98 1184 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_2_5.jpg http://images.proteinatlas.org/50/809_A_2_6.jpg Female 57 1314 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_3_5.jpg http://images.proteinatlas.org/50/809_A_3_6.jpg Endometrial cancer Tumor cells high medium low Female 79 39 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_7_2.jpg Female 75 167 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_9_1.jpg http://images.proteinatlas.org/50/809_B_9_2.jpg Female 51 300 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_7_5.jpg http://images.proteinatlas.org/50/809_B_7_6.jpg Female 56 309 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_7_7.jpg http://images.proteinatlas.org/50/809_B_7_8.jpg Female 63 312 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_9_5.jpg http://images.proteinatlas.org/50/809_B_9_6.jpg Female 59 575 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_9_7.jpg http://images.proteinatlas.org/50/809_B_9_8.jpg Female 75 658 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_8_1.jpg http://images.proteinatlas.org/50/809_B_8_2.jpg Female 63 718 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_8_3.jpg http://images.proteinatlas.org/50/809_B_8_4.jpg Female 66 1164 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_8_5.jpg http://images.proteinatlas.org/50/809_B_8_6.jpg Female 75 1165 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_8_7.jpg http://images.proteinatlas.org/50/809_B_8_8.jpg Female 60 1328 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_9_3.jpg http://images.proteinatlas.org/50/809_B_9_4.jpg Glioma Tumor cells high low not detected Male 68 3 Not detected Negative None none http://images.proteinatlas.org/50/810_A_6_1.jpg http://images.proteinatlas.org/50/810_A_6_2.jpg Female 36 34 Not detected Negative None none http://images.proteinatlas.org/50/810_A_4_5.jpg http://images.proteinatlas.org/50/810_A_4_6.jpg Male 36 38 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_4_8.jpg Male 72 45 Not detected Negative None none http://images.proteinatlas.org/50/810_A_5_3.jpg http://images.proteinatlas.org/50/810_A_5_4.jpg Male 77 46 Not detected Negative None none http://images.proteinatlas.org/50/810_A_6_3.jpg http://images.proteinatlas.org/50/810_A_6_4.jpg Male 77 94 Not detected Negative None none http://images.proteinatlas.org/50/810_A_5_5.jpg http://images.proteinatlas.org/50/810_A_5_6.jpg Female 13 95 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_4_1.jpg http://images.proteinatlas.org/50/810_A_4_2.jpg Female 60 105 Not detected Negative None none http://images.proteinatlas.org/50/810_A_5_7.jpg http://images.proteinatlas.org/50/810_A_5_8.jpg Male 56 131 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_4_3.jpg http://images.proteinatlas.org/50/810_A_4_4.jpg Female 15 158 Not detected Negative None none http://images.proteinatlas.org/50/810_A_6_7.jpg http://images.proteinatlas.org/50/810_A_6_8.jpg Female 46 176 Not detected Negative None none http://images.proteinatlas.org/50/810_A_6_6.jpg Male 69 191 Not detected Negative None none http://images.proteinatlas.org/50/810_A_5_1.jpg http://images.proteinatlas.org/50/810_A_5_2.jpg Head and neck cancer Tumor cells medium Female 74 807 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_2_1.jpg http://images.proteinatlas.org/50/810_A_2_2.jpg Female 82 903 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_2_3.jpg http://images.proteinatlas.org/50/810_A_2_4.jpg Male 70 1060 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_2_7.jpg Male 64 1130 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_2_5.jpg http://images.proteinatlas.org/50/810_A_2_6.jpg Liver cancer Tumor cells high medium low not detected Female 66 82 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_7_1.jpg http://images.proteinatlas.org/50/918_B_7_2.jpg Male 64 369 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_8_5.jpg http://images.proteinatlas.org/50/918_B_8_6.jpg Female 79 516 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_9_5.jpg http://images.proteinatlas.org/50/918_B_9_6.jpg Female 52 812 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_8_1.jpg http://images.proteinatlas.org/50/918_B_8_2.jpg Male 49 929 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_7_3.jpg http://images.proteinatlas.org/50/918_B_7_4.jpg Female 65 937 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_9_1.jpg http://images.proteinatlas.org/50/918_B_9_2.jpg Male 57 1175 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_9_7.jpg http://images.proteinatlas.org/50/918_B_9_8.jpg Male 69 1251 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_7_7.jpg http://images.proteinatlas.org/50/918_B_7_8.jpg Male 24 1287 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_8_7.jpg http://images.proteinatlas.org/50/918_B_8_8.jpg Male 47 2652 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_9_3.jpg http://images.proteinatlas.org/50/918_B_9_4.jpg Female 85 2662 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_7_5.jpg http://images.proteinatlas.org/50/918_B_7_6.jpg Lung cancer Tumor cells high medium low Male 64 376 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_2_7.jpg http://images.proteinatlas.org/50/810_B_2_8.jpg Male 75 385 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_1_5.jpg http://images.proteinatlas.org/50/810_B_1_6.jpg Male 48 426 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_2_1.jpg http://images.proteinatlas.org/50/810_B_2_2.jpg Male 60 461 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_2_3.jpg http://images.proteinatlas.org/50/810_B_2_4.jpg Female 75 496 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_3_8.jpg Female 50 537 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_2_5.jpg http://images.proteinatlas.org/50/810_B_2_6.jpg Male 60 763 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_1_7.jpg http://images.proteinatlas.org/50/810_B_1_8.jpg Male 71 1199 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_3_1.jpg http://images.proteinatlas.org/50/810_B_3_2.jpg Female 44 1249 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_3_3.jpg http://images.proteinatlas.org/50/810_B_3_4.jpg Male 68 1303 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_3_5.jpg http://images.proteinatlas.org/50/810_B_3_6.jpg Male 64 1327 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_1_1.jpg http://images.proteinatlas.org/50/810_B_1_2.jpg Male 74 2663 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_1_3.jpg http://images.proteinatlas.org/50/810_B_1_4.jpg Lymphoma Tumor cells high medium not detected Male 57 10 Not detected Negative None none http://images.proteinatlas.org/50/810_A_9_2.jpg Male 50 81 Not detected Negative None none http://images.proteinatlas.org/50/810_A_9_3.jpg http://images.proteinatlas.org/50/810_A_9_4.jpg Female 70 92 Not detected Negative None none http://images.proteinatlas.org/50/810_A_7_5.jpg Female 76 117 Not detected Negative None none http://images.proteinatlas.org/50/810_A_8_1.jpg http://images.proteinatlas.org/50/810_A_8_2.jpg Male 49 136 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_8_7.jpg http://images.proteinatlas.org/50/810_A_8_8.jpg Male 46 150 Not detected Negative None none http://images.proteinatlas.org/50/810_A_7_7.jpg http://images.proteinatlas.org/50/810_A_7_8.jpg Male 65 241 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_9_7.jpg http://images.proteinatlas.org/50/810_A_9_8.jpg Male 82 296 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_9_5.jpg http://images.proteinatlas.org/50/810_A_9_6.jpg Male 74 425 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_8_5.jpg http://images.proteinatlas.org/50/810_A_8_6.jpg Male 8 603 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_7_1.jpg http://images.proteinatlas.org/50/810_A_7_2.jpg Female 59 637 Not detected Negative None none http://images.proteinatlas.org/50/810_A_8_3.jpg http://images.proteinatlas.org/50/810_A_8_4.jpg Female 56 1090 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_7_3.jpg http://images.proteinatlas.org/50/810_A_7_4.jpg Melanoma Tumor cells high medium low not detected Male 32 168 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_6_5.jpg http://images.proteinatlas.org/50/810_B_6_6.jpg Male 76 179 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_5_3.jpg http://images.proteinatlas.org/50/810_B_5_4.jpg Male 32 462 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_6_7.jpg http://images.proteinatlas.org/50/810_B_6_8.jpg Male 51 552 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_6_1.jpg http://images.proteinatlas.org/50/810_B_6_2.jpg Female 64 656 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_5_5.jpg http://images.proteinatlas.org/50/810_B_5_6.jpg Male 44 820 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_4_1.jpg http://images.proteinatlas.org/50/810_B_4_2.jpg Male 70 837 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_4_3.jpg Female 82 896 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_4_5.jpg http://images.proteinatlas.org/50/810_B_4_6.jpg Male 67 906 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_4_7.jpg Male 80 967 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_6_3.jpg http://images.proteinatlas.org/50/810_B_6_4.jpg Female 77 1189 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_5_7.jpg http://images.proteinatlas.org/50/810_B_5_8.jpg Male 54 1205 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_5_1.jpg http://images.proteinatlas.org/50/810_B_5_2.jpg Ovarian cancer Tumor cells high medium not detected Female 52 208 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_1_3.jpg http://images.proteinatlas.org/50/809_B_1_4.jpg Female 63 393 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_3_1.jpg http://images.proteinatlas.org/50/809_B_3_2.jpg Female 71 592 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_2_7.jpg Female 85 785 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_2_1.jpg http://images.proteinatlas.org/50/809_B_2_2.jpg Female 57 825 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_1_1.jpg http://images.proteinatlas.org/50/809_B_1_2.jpg Female 84 1010 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_3_3.jpg http://images.proteinatlas.org/50/809_B_3_4.jpg Female 64 1016 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_3_5.jpg http://images.proteinatlas.org/50/809_B_3_6.jpg Female 41 1019 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_2_3.jpg http://images.proteinatlas.org/50/809_B_2_4.jpg Female 75 1106 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_1_7.jpg http://images.proteinatlas.org/50/809_B_1_8.jpg Female 77 1115 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_3_7.jpg http://images.proteinatlas.org/50/809_B_3_8.jpg Female 45 1116 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_1_5.jpg http://images.proteinatlas.org/50/809_B_1_6.jpg Female 25 1265 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_B_2_5.jpg http://images.proteinatlas.org/50/809_B_2_6.jpg Pancreatic cancer Tumor cells high medium low Female 52 170 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_5_3.jpg http://images.proteinatlas.org/50/918_B_5_4.jpg Female 66 317 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_4_3.jpg http://images.proteinatlas.org/50/918_B_4_4.jpg Male 70 582 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_6_5.jpg http://images.proteinatlas.org/50/918_B_6_6.jpg Female 64 646 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_5_1.jpg http://images.proteinatlas.org/50/918_B_5_2.jpg Female 70 823 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_5_5.jpg http://images.proteinatlas.org/50/918_B_5_6.jpg Female 70 834 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_4_1.jpg http://images.proteinatlas.org/50/918_B_4_2.jpg Male 77 893 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_4_7.jpg http://images.proteinatlas.org/50/918_B_4_8.jpg Male 69 930 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_5_7.jpg http://images.proteinatlas.org/50/918_B_5_8.jpg Male 59 969 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_6_1.jpg http://images.proteinatlas.org/50/918_B_6_2.jpg Female 57 977 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_4_5.jpg http://images.proteinatlas.org/50/918_B_4_6.jpg Male 77 1248 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_6_3.jpg http://images.proteinatlas.org/50/918_B_6_4.jpg Male 79 2650 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_6_7.jpg http://images.proteinatlas.org/50/918_B_6_8.jpg Prostate cancer Tumor cells high medium not detected Male 65 78 Not detected Negative None none http://images.proteinatlas.org/50/809_A_7_5.jpg Male 71 79 Not detected Negative None none http://images.proteinatlas.org/50/809_A_7_7.jpg http://images.proteinatlas.org/50/809_A_7_8.jpg Male 70 137 Not detected Negative None none http://images.proteinatlas.org/50/809_A_7_3.jpg http://images.proteinatlas.org/50/809_A_7_4.jpg Male 59 235 Not detected Negative None none http://images.proteinatlas.org/50/809_A_7_1.jpg http://images.proteinatlas.org/50/809_A_7_2.jpg Male 72 244 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_8_7.jpg Male 64 250 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_8_5.jpg http://images.proteinatlas.org/50/809_A_8_6.jpg Male 60 277 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_8_3.jpg Male 68 613 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_9_7.jpg http://images.proteinatlas.org/50/809_A_9_8.jpg Male 72 619 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_9_5.jpg http://images.proteinatlas.org/50/809_A_9_6.jpg Male 73 633 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_9_3.jpg http://images.proteinatlas.org/50/809_A_9_4.jpg Male 67 689 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/809_A_9_1.jpg http://images.proteinatlas.org/50/809_A_9_2.jpg Male 56 1234 Not detected Negative None none http://images.proteinatlas.org/50/809_A_8_1.jpg http://images.proteinatlas.org/50/809_A_8_2.jpg Renal cancer Tumor cells high medium low Female 83 1352 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_9_1.jpg http://images.proteinatlas.org/50/1612_A_9_2.jpg Female 60 1722 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_9_3.jpg http://images.proteinatlas.org/50/1612_A_9_4.jpg Male 46 1741 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_8_7.jpg http://images.proteinatlas.org/50/1612_A_8_8.jpg Male 79 1749 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_9_5.jpg http://images.proteinatlas.org/50/1612_A_9_6.jpg Male 56 1752 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_9_7.jpg http://images.proteinatlas.org/50/1612_A_9_8.jpg Male 68 1786 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_8_1.jpg http://images.proteinatlas.org/50/1612_A_8_2.jpg Male 77 1831 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_8_3.jpg http://images.proteinatlas.org/50/1612_A_8_4.jpg Male 61 1859 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_8_5.jpg http://images.proteinatlas.org/50/1612_A_8_6.jpg Female 56 1933 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_7_1.jpg http://images.proteinatlas.org/50/1612_A_7_2.jpg Male 63 1969 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_7_3.jpg http://images.proteinatlas.org/50/1612_A_7_4.jpg Male 71 2034 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_7_7.jpg http://images.proteinatlas.org/50/1612_A_7_8.jpg Skin cancer Tumor cells high medium low not detected Male 74 58 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_9_1.jpg http://images.proteinatlas.org/50/810_B_9_2.jpg Male 58 83 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_9_3.jpg http://images.proteinatlas.org/50/810_B_9_4.jpg Female 74 151 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_7_1.jpg http://images.proteinatlas.org/50/810_B_7_2.jpg Male 82 155 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_7_3.jpg http://images.proteinatlas.org/50/810_B_7_4.jpg Male 44 173 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_9_5.jpg http://images.proteinatlas.org/50/810_B_9_6.jpg Male 57 229 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_7_5.jpg http://images.proteinatlas.org/50/810_B_7_6.jpg Male 77 236 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_8_3.jpg http://images.proteinatlas.org/50/810_B_8_4.jpg Male 61 456 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_8_7.jpg http://images.proteinatlas.org/50/810_B_8_8.jpg Male 84 561 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_8_5.jpg http://images.proteinatlas.org/50/810_B_8_6.jpg Male 81 674 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_7_7.jpg http://images.proteinatlas.org/50/810_B_7_8.jpg Male 89 1166 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_B_8_1.jpg http://images.proteinatlas.org/50/810_B_8_2.jpg Female 62 1231 Not detected Negative None none http://images.proteinatlas.org/50/810_B_9_8.jpg Stomach cancer Tumor cells high medium not detected Male 80 198 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_2_1.jpg http://images.proteinatlas.org/50/918_B_2_2.jpg Male 72 388 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_1_5.jpg http://images.proteinatlas.org/50/918_B_1_6.jpg Female 76 446 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_3_7.jpg http://images.proteinatlas.org/50/918_B_3_8.jpg Female 86 549 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_3_3.jpg http://images.proteinatlas.org/50/918_B_3_4.jpg Female 50 664 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_2_7.jpg http://images.proteinatlas.org/50/918_B_2_8.jpg Male 71 703 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_1_7.jpg http://images.proteinatlas.org/50/918_B_1_8.jpg Male 77 893 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_1_3.jpg http://images.proteinatlas.org/50/918_B_1_4.jpg Male 76 1073 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_2_3.jpg http://images.proteinatlas.org/50/918_B_2_4.jpg Male 88 1158 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_3_1.jpg http://images.proteinatlas.org/50/918_B_3_2.jpg Male 78 1186 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_1_1.jpg http://images.proteinatlas.org/50/918_B_1_2.jpg Male 63 1207 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_3_5.jpg http://images.proteinatlas.org/50/918_B_3_6.jpg Male 47 1266 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/918_B_2_5.jpg http://images.proteinatlas.org/50/918_B_2_6.jpg Testis cancer Tumor cells high medium low not detected Male 52 138 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_1_7.jpg http://images.proteinatlas.org/50/1612_A_1_8.jpg Male 39 411 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_1_5.jpg http://images.proteinatlas.org/50/1612_A_1_6.jpg Male 28 1179 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_3_7.jpg http://images.proteinatlas.org/50/1612_A_3_8.jpg Male 21 1340 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_3_1.jpg http://images.proteinatlas.org/50/1612_A_3_2.jpg Male 34 1344 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_2_1.jpg http://images.proteinatlas.org/50/1612_A_2_2.jpg Male 33 1462 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_2_3.jpg http://images.proteinatlas.org/50/1612_A_2_4.jpg Male 41 1700 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_2_5.jpg http://images.proteinatlas.org/50/1612_A_2_6.jpg Male 36 1740 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_3_5.jpg http://images.proteinatlas.org/50/1612_A_3_6.jpg Male 43 1777 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_2_7.jpg http://images.proteinatlas.org/50/1612_A_2_8.jpg Male 71 1818 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_1_1.jpg Male 59 1900 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_1_3.jpg http://images.proteinatlas.org/50/1612_A_1_4.jpg Male 26 1995 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_3_3.jpg http://images.proteinatlas.org/50/1612_A_3_4.jpg Thyroid cancer Tumor cells medium not detected Male 76 306 Not detected Negative None none http://images.proteinatlas.org/50/810_A_3_1.jpg http://images.proteinatlas.org/50/810_A_3_2.jpg Male 87 348 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/810_A_3_7.jpg http://images.proteinatlas.org/50/810_A_3_8.jpg Female 71 923 Not detected Negative None none http://images.proteinatlas.org/50/810_A_3_3.jpg http://images.proteinatlas.org/50/810_A_3_4.jpg Female 71 985 Not detected Negative None none http://images.proteinatlas.org/50/810_A_3_5.jpg http://images.proteinatlas.org/50/810_A_3_6.jpg Urothelial cancer Tumor cells high medium low Female 81 662 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_6_5.jpg http://images.proteinatlas.org/50/1612_A_6_6.jpg Male 85 799 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_4_5.jpg http://images.proteinatlas.org/50/1612_A_4_6.jpg Male 86 944 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_4_7.jpg http://images.proteinatlas.org/50/1612_A_4_8.jpg Male 78 1441 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_6_7.jpg http://images.proteinatlas.org/50/1612_A_6_8.jpg Male 74 1651 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_5_1.jpg http://images.proteinatlas.org/50/1612_A_5_2.jpg Male 50 1717 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_5_3.jpg http://images.proteinatlas.org/50/1612_A_5_4.jpg Male 56 1760 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_5_5.jpg http://images.proteinatlas.org/50/1612_A_5_6.jpg Male 55 1798 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_5_7.jpg http://images.proteinatlas.org/50/1612_A_5_8.jpg Male 66 1824 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_4_2.jpg Female 85 1871 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_6_1.jpg http://images.proteinatlas.org/50/1612_A_6_2.jpg Male 57 1906 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_4_3.jpg http://images.proteinatlas.org/50/1612_A_4_4.jpg Female 80 2031 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/50/1612_A_6_3.jpg http://images.proteinatlas.org/50/1612_A_6_4.jpg

supported No tissue staining or RNA expression data available for comparison Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/16533/ihc_selected.jpg Adipose tissue Adipocytes medium moderate >75% cytoplasmic/membranous Female 50 1176 http://images.proteinatlas.org/16533/36341_B_3_8.jpg Female 75 2042 http://images.proteinatlas.org/16533/36341_B_1_7.jpg Male 72 2178 http://images.proteinatlas.org/16533/36341_B_2_8.jpg Male 83 2360 http://images.proteinatlas.org/16533/36341_B_3_7.jpg Female 35 2587 http://images.proteinatlas.org/16533/36341_B_2_7.jpg Female 53 3482 http://images.proteinatlas.org/16533/36341_B_1_8.jpg Adrenal gland Glandular cells low weak 75%-25% cytoplasmic/membranous Female 47 2741 http://images.proteinatlas.org/16533/36341_B_5_5.jpg Female 59 3238 http://images.proteinatlas.org/16533/36341_B_4_5.jpg Male 56 3444 http://images.proteinatlas.org/16533/36341_B_6_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue low weak >75% cytoplasmic/membranous Female 77 1896 http://images.proteinatlas.org/16533/36341_A_2_2.jpg Male 56 1993 http://images.proteinatlas.org/16533/36341_A_3_2.jpg Female 20 2444 http://images.proteinatlas.org/16533/36341_A_1_2.jpg Bone marrow Hematopoietic cells low moderate <25% cytoplasmic/membranous Male 63 3423 http://images.proteinatlas.org/16533/36341_B_6_4.jpg Breast Adipocytes low weak 75%-25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous Myoepithelial cells not detected negative none none Female 23 2773 http://images.proteinatlas.org/16533/36341_B_1_4.jpg Female 59 2805 http://images.proteinatlas.org/16533/36341_B_3_4.jpg Bronchus Respiratory epithelial cells low weak >75% cytoplasmic/membranous Female 54 2393 http://images.proteinatlas.org/16533/36341_B_5_2.jpg Male 77 3404 http://images.proteinatlas.org/16533/36341_B_6_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/16533/36341_B_9_7.jpg Female 54 2523 http://images.proteinatlas.org/16533/36341_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/16533/36341_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/16533/36341_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/16533/36341_B_9_8.jpg Female 19 2524 http://images.proteinatlas.org/16533/36341_B_8_8.jpg Cerebral cortex Endothelial cells not detected negative none none Neuronal cells not detected negative none none Neuropil not detected negative none none Female 30 1582 http://images.proteinatlas.org/16533/36341_B_8_5.jpg Male 45 2521 http://images.proteinatlas.org/16533/36341_B_7_5.jpg Male 57 2927 http://images.proteinatlas.org/16533/36341_B_9_5.jpg Cervix Squamous epithelial cells medium moderate 75%-25% cytoplasmic/membranous Female 55 2005 http://images.proteinatlas.org/16533/36341_B_8_3.jpg Female 39 3313 http://images.proteinatlas.org/16533/36341_B_9_3.jpg Colon Endothelial cells high strong >75% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Peripheral nerve/ganglion low weak >75% cytoplasmic/membranous Female 56 1423 http://images.proteinatlas.org/16533/36341_A_7_3.jpg Female 80 2944 http://images.proteinatlas.org/16533/36341_A_9_3.jpg Male 73 3266 http://images.proteinatlas.org/16533/36341_A_8_3.jpg Duodenum Glandular cells not detected negative none none Male 50 1904 http://images.proteinatlas.org/16533/36341_A_7_2.jpg Male 54 2562 http://images.proteinatlas.org/16533/36341_A_9_2.jpg Female 71 3004 http://images.proteinatlas.org/16533/36341_A_8_2.jpg Endometrium 1 Cells in endometrial stroma low weak 75%-25% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Female 42 2242 http://images.proteinatlas.org/16533/36341_B_5_3.jpg Female 33 2941 http://images.proteinatlas.org/16533/36341_B_6_3.jpg Female 39 3313 http://images.proteinatlas.org/16533/36341_B_4_3.jpg Endometrium 2 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 50 1658 http://images.proteinatlas.org/16533/36341_B_2_3.jpg Female 50 2206 http://images.proteinatlas.org/16533/36341_B_1_3.jpg Female 51 3491 http://images.proteinatlas.org/16533/36341_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 46 589 http://images.proteinatlas.org/16533/36341_A_2_6.jpg Male 36 1740 http://images.proteinatlas.org/16533/36341_A_3_6.jpg Male 56 3355 http://images.proteinatlas.org/16533/36341_A_1_6.jpg Esophagus Squamous epithelial cells not detected negative none none Female 72 2794 http://images.proteinatlas.org/16533/36341_B_4_1.jpg Male 48 3044 http://images.proteinatlas.org/16533/36341_B_6_1.jpg Male 54 3197 http://images.proteinatlas.org/16533/36341_B_5_1.jpg Fallopian tube Glandular cells medium moderate 75%-25% cytoplasmic/membranous Female 23 2138 http://images.proteinatlas.org/16533/36341_A_7_7.jpg Female 34 2382 http://images.proteinatlas.org/16533/36341_A_8_7.jpg Female 32 2447 http://images.proteinatlas.org/16533/36341_A_9_7.jpg Gallbladder Glandular cells not detected weak <25% cytoplasmic/membranous Female 64 2025 http://images.proteinatlas.org/16533/36341_A_5_4.jpg Female 26 2446 http://images.proteinatlas.org/16533/36341_A_4_4.jpg Male 54 2562 http://images.proteinatlas.org/16533/36341_A_6_4.jpg Heart muscle Cardiomyocytes not detected weak <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/16533/36341_B_4_6.jpg Female 54 2523 http://images.proteinatlas.org/16533/36341_B_5_6.jpg Female 19 2524 http://images.proteinatlas.org/16533/36341_B_6_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/16533/36341_B_9_6.jpg Female 54 2523 http://images.proteinatlas.org/16533/36341_B_8_6.jpg Female 19 2524 http://images.proteinatlas.org/16533/36341_B_7_6.jpg Kidney Cells in glomeruli low weak >75% cytoplasmic/membranous Cells in tubules medium moderate 75%-25% cytoplasmic/membranous Male 16 1767 http://images.proteinatlas.org/16533/36341_A_8_5.jpg Female 56 1933 http://images.proteinatlas.org/16533/36341_A_9_5.jpg Male 59 3229 http://images.proteinatlas.org/16533/36341_A_7_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes not detected weak <25% cytoplasmic/membranous Male 55 2429 http://images.proteinatlas.org/16533/36341_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/16533/36341_A_9_4.jpg Male 73 3378 http://images.proteinatlas.org/16533/36341_A_7_4.jpg Lung Alveolar cells low weak >75% cytoplasmic/membranous Macrophages medium moderate >75% cytoplasmic/membranous Male 21 2101 http://images.proteinatlas.org/16533/36341_A_1_4.jpg Male 59 2222 http://images.proteinatlas.org/16533/36341_A_3_4.jpg Female 49 2268 http://images.proteinatlas.org/16533/36341_A_2_4.jpg Lymph node Germinal center cells medium moderate >75% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Male 55 1724 http://images.proteinatlas.org/16533/36341_A_7_8.jpg Female 53 3285 http://images.proteinatlas.org/16533/36341_A_9_8.jpg Nasopharynx Respiratory epithelial cells low weak >75% cytoplasmic/membranous Male 48 2402 http://images.proteinatlas.org/16533/36341_B_8_2.jpg Male 22 3362 http://images.proteinatlas.org/16533/36341_B_7_2.jpg Oral mucosa Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 58 3135 http://images.proteinatlas.org/16533/36341_A_7_1.jpg Ovary Follicle cells not detected negative none none Ovarian stroma cells not detected weak <25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/16533/36341_A_5_7.jpg Female 33 2159 http://images.proteinatlas.org/16533/36341_A_4_7.jpg Female 41 2713 http://images.proteinatlas.org/16533/36341_A_6_7.jpg Pancreas Exocrine glandular cells not detected weak <25% cytoplasmic/membranous Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/16533/36341_A_3_3.jpg Female 70 3320 http://images.proteinatlas.org/16533/36341_A_2_3.jpg Parathyroid gland Glandular cells low moderate <25% cytoplasmic/membranous Female 86 3176 http://images.proteinatlas.org/16533/36341_A_2_8.jpg Placenta Decidual cells not detected weak <25% cytoplasmic/membranous Trophoblastic cells medium moderate 75%-25% cytoplasmic/membranous Female 18 2390 http://images.proteinatlas.org/16533/36341_A_2_7.jpg Female 30 2515 http://images.proteinatlas.org/16533/36341_A_1_7.jpg Female 30 2903 http://images.proteinatlas.org/16533/36341_A_3_7.jpg Prostate Glandular cells not detected weak <25% cytoplasmic/membranous Male 51 2053 http://images.proteinatlas.org/16533/36341_A_3_5.jpg Male 60 2098 http://images.proteinatlas.org/16533/36341_A_2_5.jpg Male 76 2932 http://images.proteinatlas.org/16533/36341_A_1_5.jpg Rectum Glandular cells not detected negative none none Female 66 2060 http://images.proteinatlas.org/16533/36341_A_5_3.jpg Salivary gland Glandular cells not detected weak <25% cytoplasmic/membranous Male 63 1845 http://images.proteinatlas.org/16533/36341_B_1_1.jpg Male 3 2405 http://images.proteinatlas.org/16533/36341_B_3_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 64 1938 http://images.proteinatlas.org/16533/36341_A_9_6.jpg Male 68 3297 http://images.proteinatlas.org/16533/36341_A_8_6.jpg Skeletal muscle Myocytes not detected negative none none Male 83 2360 http://images.proteinatlas.org/16533/36341_B_2_6.jpg Female 84 2406 http://images.proteinatlas.org/16533/36341_B_1_6.jpg Male 51 2608 http://images.proteinatlas.org/16533/36341_B_3_6.jpg Skin 1 Fibroblasts low weak 75%-25% cytoplasmic/membranous Keratinocytes medium moderate 75%-25% cytoplasmic/membranous Langerhans low weak 75%-25% cytoplasmic/membranous Melanocytes low weak >75% cytoplasmic/membranous Male 53 2534 http://images.proteinatlas.org/16533/36341_B_7_1.jpg Skin 2 Epidermal cells low weak 75%-25% cytoplasmic/membranous Female 73 3318 http://images.proteinatlas.org/16533/36341_B_5_8.jpg Female 54 3403 http://images.proteinatlas.org/16533/36341_B_4_8.jpg Small intestine Glandular cells not detected negative none none Female 84 2256 http://images.proteinatlas.org/16533/36341_A_5_2.jpg Female 56 3343 http://images.proteinatlas.org/16533/36341_A_6_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 33 2175 http://images.proteinatlas.org/16533/36341_B_4_7.jpg Male 67 2404 http://images.proteinatlas.org/16533/36341_B_5_7.jpg Soft tissue 1 Fibroblasts not detected weak <25% cytoplasmic/membranous Peripheral nerve low weak >75% cytoplasmic/membranous Female 50 1176 http://images.proteinatlas.org/16533/36341_B_3_8.jpg Male 72 2178 http://images.proteinatlas.org/16533/36341_B_2_8.jpg Female 53 3482 http://images.proteinatlas.org/16533/36341_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Female 75 2042 http://images.proteinatlas.org/16533/36341_B_1_7.jpg Male 83 2360 http://images.proteinatlas.org/16533/36341_B_3_7.jpg Female 35 2587 http://images.proteinatlas.org/16533/36341_B_2_7.jpg Spleen Cells in red pulp medium strong <25% cytoplasmic/membranous Cells in white pulp not detected weak <25% cytoplasmic/membranous Male 72 1714 http://images.proteinatlas.org/16533/36341_B_7_4.jpg Female 74 2162 http://images.proteinatlas.org/16533/36341_B_9_4.jpg Male 36 2940 http://images.proteinatlas.org/16533/36341_B_8_4.jpg Stomach 1 Glandular cells not detected negative none none Female 56 2130 http://images.proteinatlas.org/16533/36341_A_5_1.jpg Male 72 2583 http://images.proteinatlas.org/16533/36341_A_4_1.jpg Male 39 3368 http://images.proteinatlas.org/16533/36341_A_6_1.jpg Stomach 2 Glandular cells not detected weak <25% cytoplasmic/membranous Female 75 1534 http://images.proteinatlas.org/16533/36341_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/16533/36341_A_1_1.jpg Female 56 3233 http://images.proteinatlas.org/16533/36341_A_3_1.jpg Testis Cells in seminiferous ducts not detected weak <25% cytoplasmic/membranous Leydig cells medium moderate >75% cytoplasmic/membranous Male 71 1818 http://images.proteinatlas.org/16533/36341_A_4_6.jpg Male 26 2254 http://images.proteinatlas.org/16533/36341_A_5_6.jpg Male 46 2435 http://images.proteinatlas.org/16533/36341_A_6_6.jpg Thyroid gland Glandular cells not detected negative none none Male 56 1672 http://images.proteinatlas.org/16533/36341_B_2_5.jpg Female 44 3005 http://images.proteinatlas.org/16533/36341_B_3_5.jpg Female 28 3536 http://images.proteinatlas.org/16533/36341_B_1_5.jpg Tonsil Germinal center cells low weak >75% cytoplasmic/membranous Non-germinal center cells medium strong <25% cytoplasmic/membranous Squamous epithelial cells medium moderate 75%-25% cytoplasmic/membranous Male 37 2512 http://images.proteinatlas.org/16533/36341_A_6_8.jpg Male 17 2615 http://images.proteinatlas.org/16533/36341_A_5_8.jpg Female 19 3294 http://images.proteinatlas.org/16533/36341_A_4_8.jpg Urinary bladder Urothelial cells medium moderate 75%-25% cytoplasmic/membranous Male 46 3186 http://images.proteinatlas.org/16533/36341_A_5_5.jpg Female 79 3265 http://images.proteinatlas.org/16533/36341_A_6_5.jpg Vagina Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Female 34 1751 http://images.proteinatlas.org/16533/36341_B_1_2.jpg

Breast cancer Tumor cells low not detected Female 80 1874 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_6_1.jpg http://images.proteinatlas.org/16533/36338_A_6_2.jpg Female 46 1882 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_4_3.jpg http://images.proteinatlas.org/16533/36338_A_4_4.jpg Female 61 1910 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_6_7.jpg http://images.proteinatlas.org/16533/36338_A_6_8.jpg Female 87 1939 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_6_5.jpg http://images.proteinatlas.org/16533/36338_A_6_6.jpg Female 51 2083 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_4_6.jpg Female 40 2091 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_4_7.jpg http://images.proteinatlas.org/16533/36338_A_4_8.jpg Female 27 2392 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_6_4.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_5_3.jpg http://images.proteinatlas.org/16533/36338_A_5_4.jpg Female 59 2805 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_5_1.jpg http://images.proteinatlas.org/16533/36338_A_5_2.jpg Female 41 2898 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_4_1.jpg http://images.proteinatlas.org/16533/36338_A_4_2.jpg Carcinoid Tumor cells medium low not detected Male 41 2618 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/16533/36339_A_1_7.jpg http://images.proteinatlas.org/16533/36339_A_1_8.jpg Female 52 3043 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_1_3.jpg http://images.proteinatlas.org/16533/36339_A_1_4.jpg Male 30 3171 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_1_2.jpg Male 57 3181 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_1_5.jpg http://images.proteinatlas.org/16533/36339_A_1_6.jpg Cervical cancer Tumor cells medium low not detected Female 55 470 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_6_1.jpg http://images.proteinatlas.org/16533/36364_B_6_2.jpg Female 39 1716 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_4_3.jpg http://images.proteinatlas.org/16533/36364_B_4_4.jpg Female 34 1751 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_5_1.jpg http://images.proteinatlas.org/16533/36364_B_5_2.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_4_6.jpg Female 44 2480 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_5_5.jpg http://images.proteinatlas.org/16533/36364_B_5_6.jpg Female 44 2528 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_6_7.jpg http://images.proteinatlas.org/16533/36364_B_6_8.jpg Female 70 3382 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_6_5.jpg http://images.proteinatlas.org/16533/36364_B_6_6.jpg Female 46 3400 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_5_7.jpg http://images.proteinatlas.org/16533/36364_B_5_8.jpg Female 63 3409 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_5_4.jpg Female 39 3500 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_6_3.jpg http://images.proteinatlas.org/16533/36364_B_6_4.jpg Colorectal cancer Tumor cells medium low not detected Male 71 1898 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_2_3.jpg http://images.proteinatlas.org/16533/36338_A_2_4.jpg Female 84 1958 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_1_5.jpg http://images.proteinatlas.org/16533/36338_A_1_6.jpg Female 66 2060 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_3_7.jpg http://images.proteinatlas.org/16533/36338_A_3_8.jpg Male 72 2096 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_3_3.jpg http://images.proteinatlas.org/16533/36338_A_3_4.jpg Female 86 2106 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_1_1.jpg http://images.proteinatlas.org/16533/36338_A_1_2.jpg Female 75 2151 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_3_5.jpg http://images.proteinatlas.org/16533/36338_A_3_6.jpg Female 66 2948 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_2_5.jpg Male 72 3074 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_1_7.jpg http://images.proteinatlas.org/16533/36338_A_1_8.jpg Male 63 3408 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_1_3.jpg Endometrial cancer Tumor cells medium low not detected Female 83 1750 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_9_7.jpg http://images.proteinatlas.org/16533/36364_B_9_8.jpg Female 86 1881 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_9_1.jpg http://images.proteinatlas.org/16533/36364_B_9_2.jpg Female 70 2118 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_7_1.jpg http://images.proteinatlas.org/16533/36364_B_7_2.jpg Female 79 2339 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_9_3.jpg http://images.proteinatlas.org/16533/36364_B_9_4.jpg Female 58 2455 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_8_1.jpg http://images.proteinatlas.org/16533/36364_B_8_2.jpg Female 81 2607 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_8_5.jpg http://images.proteinatlas.org/16533/36364_B_8_6.jpg Female 58 2621 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_7_7.jpg http://images.proteinatlas.org/16533/36364_B_7_8.jpg Female 63 2772 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_7_3.jpg http://images.proteinatlas.org/16533/36364_B_7_4.jpg Female 32 3036 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_9_5.jpg http://images.proteinatlas.org/16533/36364_B_9_6.jpg Female 85 3319 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_7_5.jpg http://images.proteinatlas.org/16533/36364_B_7_6.jpg Female 70 3367 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_8_3.jpg http://images.proteinatlas.org/16533/36364_B_8_4.jpg Glioma Tumor cells medium low not detected Male 77 1537 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_5_7.jpg http://images.proteinatlas.org/16533/36339_A_5_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_4_1.jpg http://images.proteinatlas.org/16533/36339_A_4_2.jpg Male 33 1627 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_6_3.jpg http://images.proteinatlas.org/16533/36339_A_6_4.jpg Female 59 1645 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_6_5.jpg http://images.proteinatlas.org/16533/36339_A_6_6.jpg Female 37 2529 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_5_3.jpg http://images.proteinatlas.org/16533/36339_A_5_4.jpg Male 60 2726 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_6_1.jpg http://images.proteinatlas.org/16533/36339_A_6_2.jpg Male 71 3091 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_6_7.jpg http://images.proteinatlas.org/16533/36339_A_6_8.jpg Male 38 3120 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_4_3.jpg http://images.proteinatlas.org/16533/36339_A_4_4.jpg Male 77 3137 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_4_5.jpg http://images.proteinatlas.org/16533/36339_A_4_6.jpg Male 32 3151 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_5_5.jpg http://images.proteinatlas.org/16533/36339_A_5_6.jpg Female 22 3174 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_5_1.jpg http://images.proteinatlas.org/16533/36339_A_5_2.jpg Female 58 3241 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_4_7.jpg http://images.proteinatlas.org/16533/36339_A_4_8.jpg Head and neck cancer Tumor cells low not detected Male 62 1743 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_2_3.jpg http://images.proteinatlas.org/16533/36339_A_2_4.jpg Male 66 2547 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_2_5.jpg http://images.proteinatlas.org/16533/36339_A_2_6.jpg Male 51 2608 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_2_1.jpg http://images.proteinatlas.org/16533/36339_A_2_2.jpg Female 76 3621 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_2_7.jpg http://images.proteinatlas.org/16533/36339_A_2_8.jpg Liver cancer Tumor cells medium low not detected Female 65 937 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_7_5.jpg Male 55 1163 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_8_5.jpg http://images.proteinatlas.org/16533/36340_B_8_6.jpg Female 58 2177 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_8_1.jpg http://images.proteinatlas.org/16533/36340_B_8_2.jpg Female 73 2279 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_7_1.jpg http://images.proteinatlas.org/16533/36340_B_7_2.jpg Male 80 2280 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_9_1.jpg http://images.proteinatlas.org/16533/36340_B_9_2.jpg Male 72 2556 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/16533/36340_B_9_3.jpg http://images.proteinatlas.org/16533/36340_B_9_4.jpg Female 73 2766 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_7_7.jpg http://images.proteinatlas.org/16533/36340_B_7_8.jpg Female 61 3215 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_7_3.jpg http://images.proteinatlas.org/16533/36340_B_7_4.jpg Lung cancer Tumor cells high medium not detected Male 57 1428 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_2_3.jpg http://images.proteinatlas.org/16533/36339_B_2_4.jpg Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_1_7.jpg http://images.proteinatlas.org/16533/36339_B_1_8.jpg Male 64 1847 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_3_5.jpg http://images.proteinatlas.org/16533/36339_B_3_6.jpg Male 59 2222 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_3_7.jpg http://images.proteinatlas.org/16533/36339_B_3_8.jpg Male 71 2231 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_2_7.jpg Male 61 2354 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_2_5.jpg http://images.proteinatlas.org/16533/36339_B_2_6.jpg Female 65 2403 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_3_4.jpg Male 49 3003 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_2_1.jpg http://images.proteinatlas.org/16533/36339_B_2_2.jpg Female 73 3016 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_1_3.jpg http://images.proteinatlas.org/16533/36339_B_1_4.jpg Female 51 3052 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_3_1.jpg http://images.proteinatlas.org/16533/36339_B_3_2.jpg Female 70 3391 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_1_1.jpg http://images.proteinatlas.org/16533/36339_B_1_2.jpg Lymphoma Tumor cells low not detected Female 50 1596 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_7_7.jpg http://images.proteinatlas.org/16533/36339_A_7_8.jpg Female 36 1606 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_7_6.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_7_1.jpg http://images.proteinatlas.org/16533/36339_A_7_2.jpg Female 19 1734 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_8_7.jpg http://images.proteinatlas.org/16533/36339_A_8_8.jpg Male 18 2604 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_9_7.jpg http://images.proteinatlas.org/16533/36339_A_9_8.jpg Male 66 2731 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_9_1.jpg http://images.proteinatlas.org/16533/36339_A_9_2.jpg Female 67 2751 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_9_5.jpg http://images.proteinatlas.org/16533/36339_A_9_6.jpg Male 83 2883 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_8_1.jpg http://images.proteinatlas.org/16533/36339_A_8_2.jpg Female 76 3010 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_8_5.jpg http://images.proteinatlas.org/16533/36339_A_8_6.jpg Male 76 3078 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_8_4.jpg Male 61 3085 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_7_3.jpg http://images.proteinatlas.org/16533/36339_A_7_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_9_3.jpg http://images.proteinatlas.org/16533/36339_A_9_4.jpg Melanoma Tumor cells medium low not detected Female 104 777 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_5_3.jpg http://images.proteinatlas.org/16533/36339_B_5_4.jpg Male 84 933 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_5_1.jpg http://images.proteinatlas.org/16533/36339_B_5_2.jpg Male 79 1369 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_6_3.jpg http://images.proteinatlas.org/16533/36339_B_6_4.jpg Male 59 1414 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_6_5.jpg http://images.proteinatlas.org/16533/36339_B_6_6.jpg Male 61 1482 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_6_7.jpg http://images.proteinatlas.org/16533/36339_B_6_8.jpg Male 41 2112 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_5_7.jpg http://images.proteinatlas.org/16533/36339_B_5_8.jpg Female 87 2136 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_4_5.jpg http://images.proteinatlas.org/16533/36339_B_4_6.jpg Male 53 2534 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_4_1.jpg http://images.proteinatlas.org/16533/36339_B_4_2.jpg Female 30 2598 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_5_5.jpg http://images.proteinatlas.org/16533/36339_B_5_6.jpg Female 73 2900 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_4_7.jpg http://images.proteinatlas.org/16533/36339_B_4_8.jpg Female 82 3060 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_6_1.jpg http://images.proteinatlas.org/16533/36339_B_6_2.jpg Male 59 3351 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_4_3.jpg Ovarian cancer Tumor cells high medium low not detected Female 73 1844 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_2_3.jpg http://images.proteinatlas.org/16533/36364_B_2_4.jpg Female 51 1911 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_3_5.jpg http://images.proteinatlas.org/16533/36364_B_3_6.jpg Female 57 2082 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_2_1.jpg http://images.proteinatlas.org/16533/36364_B_2_2.jpg Female 59 2347 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_1_1.jpg http://images.proteinatlas.org/16533/36364_B_1_2.jpg Female 69 2391 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_3_7.jpg Female 62 2568 High Strong >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/16533/36364_B_1_3.jpg http://images.proteinatlas.org/16533/36364_B_1_4.jpg Female 79 2889 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_1_5.jpg http://images.proteinatlas.org/16533/36364_B_1_6.jpg Female 44 3146 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36364_B_1_7.jpg http://images.proteinatlas.org/16533/36364_B_1_8.jpg Female 61 3323 Not detected Negative None none http://images.proteinatlas.org/16533/36364_B_2_5.jpg http://images.proteinatlas.org/16533/36364_B_2_6.jpg Pancreatic cancer Tumor cells medium low not detected Male 70 729 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_6_3.jpg http://images.proteinatlas.org/16533/36340_B_6_4.jpg Male 74 833 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_6_1.jpg http://images.proteinatlas.org/16533/36340_B_6_2.jpg Female 70 834 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_5_3.jpg http://images.proteinatlas.org/16533/36340_B_5_4.jpg Male 63 1647 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_4_1.jpg http://images.proteinatlas.org/16533/36340_B_4_2.jpg Male 50 1904 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/16533/36340_B_6_5.jpg http://images.proteinatlas.org/16533/36340_B_6_6.jpg Female 71 3004 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_4_3.jpg http://images.proteinatlas.org/16533/36340_B_4_4.jpg Female 56 3233 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_4_5.jpg http://images.proteinatlas.org/16533/36340_B_4_6.jpg Female 78 3363 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_5_5.jpg http://images.proteinatlas.org/16533/36340_B_5_6.jpg Prostate cancer Tumor cells medium low not detected Male 89 2828 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_7_6.jpg Male 55 3316 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_8_3.jpg http://images.proteinatlas.org/16533/36338_A_8_4.jpg Male 61 3486 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_8_7.jpg http://images.proteinatlas.org/16533/36338_A_8_8.jpg Male 50 3559 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_7_1.jpg http://images.proteinatlas.org/16533/36338_A_7_2.jpg Male 65 3572 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/16533/36338_A_7_7.jpg http://images.proteinatlas.org/16533/36338_A_7_8.jpg Male 63 3573 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_9_1.jpg http://images.proteinatlas.org/16533/36338_A_9_2.jpg Male 60 3577 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_9_3.jpg http://images.proteinatlas.org/16533/36338_A_9_4.jpg Male 61 3579 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_9_7.jpg http://images.proteinatlas.org/16533/36338_A_9_8.jpg Male 69 3580 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36338_A_8_5.jpg http://images.proteinatlas.org/16533/36338_A_8_6.jpg Male 64 3581 Not detected Negative None none http://images.proteinatlas.org/16533/36338_A_8_2.jpg Renal cancer Tumor cells medium low not detected Female 70 1498 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_7_3.jpg Female 60 1722 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_7_1.jpg http://images.proteinatlas.org/16533/36340_A_7_2.jpg Male 56 1752 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_8_1.jpg http://images.proteinatlas.org/16533/36340_A_8_2.jpg Male 77 1831 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_8_5.jpg http://images.proteinatlas.org/16533/36340_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_9_3.jpg http://images.proteinatlas.org/16533/36340_A_9_4.jpg Male 63 1969 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_9_1.jpg http://images.proteinatlas.org/16533/36340_A_9_2.jpg Female 72 2067 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_7_5.jpg http://images.proteinatlas.org/16533/36340_A_7_6.jpg Male 59 2176 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_7_7.jpg http://images.proteinatlas.org/16533/36340_A_7_8.jpg Male 68 2452 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_8_3.jpg http://images.proteinatlas.org/16533/36340_A_8_4.jpg Male 61 2540 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_9_7.jpg http://images.proteinatlas.org/16533/36340_A_9_8.jpg Female 52 2564 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_8_8.jpg Female 57 3061 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_9_5.jpg http://images.proteinatlas.org/16533/36340_A_9_6.jpg Skin cancer Tumor cells medium low not detected Male 75 2111 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_7_3.jpg http://images.proteinatlas.org/16533/36339_B_7_4.jpg Male 74 2171 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_9_6.jpg Female 42 2285 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_8_5.jpg http://images.proteinatlas.org/16533/36339_B_8_6.jpg Male 67 2800 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_9_3.jpg http://images.proteinatlas.org/16533/36339_B_9_4.jpg Male 93 2809 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_7_1.jpg http://images.proteinatlas.org/16533/36339_B_7_2.jpg Male 86 3014 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_7_5.jpg http://images.proteinatlas.org/16533/36339_B_7_6.jpg Male 60 3054 Not detected Negative None none http://images.proteinatlas.org/16533/36339_B_9_7.jpg http://images.proteinatlas.org/16533/36339_B_9_8.jpg Female 88 3163 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_7_7.jpg http://images.proteinatlas.org/16533/36339_B_7_8.jpg Female 44 3261 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_8_1.jpg http://images.proteinatlas.org/16533/36339_B_8_2.jpg Male 85 3328 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_9_1.jpg http://images.proteinatlas.org/16533/36339_B_9_2.jpg Female 59 3520 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_B_8_7.jpg http://images.proteinatlas.org/16533/36339_B_8_8.jpg Stomach cancer Tumor cells medium not detected Male 77 832 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_3_7.jpg http://images.proteinatlas.org/16533/36340_B_3_8.jpg Female 71 1061 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_3_3.jpg http://images.proteinatlas.org/16533/36340_B_3_4.jpg Female 75 1534 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_2_1.jpg http://images.proteinatlas.org/16533/36340_B_2_2.jpg Male 82 1787 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_1_2.jpg Male 76 2066 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_1_3.jpg http://images.proteinatlas.org/16533/36340_B_1_4.jpg Male 62 2105 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_1_7.jpg http://images.proteinatlas.org/16533/36340_B_1_8.jpg Male 62 2142 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_2_7.jpg http://images.proteinatlas.org/16533/36340_B_2_8.jpg Female 65 2326 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_2_6.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_3_5.jpg http://images.proteinatlas.org/16533/36340_B_3_6.jpg Male 59 2473 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_B_2_3.jpg http://images.proteinatlas.org/16533/36340_B_2_4.jpg Female 73 2557 Not detected Negative None none http://images.proteinatlas.org/16533/36340_B_1_5.jpg Testis cancer Tumor cells medium low not detected Male 28 1179 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_3_3.jpg http://images.proteinatlas.org/16533/36340_A_3_4.jpg Male 21 1340 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_1_6.jpg Male 41 1700 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/16533/36340_A_3_5.jpg http://images.proteinatlas.org/16533/36340_A_3_6.jpg Male 36 1740 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_1_7.jpg Male 43 1777 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_2_5.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_2_4.jpg Male 59 1900 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_2_1.jpg http://images.proteinatlas.org/16533/36340_A_2_2.jpg Male 65 2558 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_2_7.jpg http://images.proteinatlas.org/16533/36340_A_2_8.jpg Male 22 2721 Not detected Weak <25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/16533/36340_A_3_7.jpg http://images.proteinatlas.org/16533/36340_A_3_8.jpg Thyroid cancer Tumor cells medium low not detected Male 77 2623 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_3_5.jpg http://images.proteinatlas.org/16533/36339_A_3_6.jpg Male 75 3107 Not detected Negative None none http://images.proteinatlas.org/16533/36339_A_3_3.jpg http://images.proteinatlas.org/16533/36339_A_3_4.jpg Male 33 3267 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_3_1.jpg http://images.proteinatlas.org/16533/36339_A_3_2.jpg Female 42 3490 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/16533/36339_A_3_7.jpg http://images.proteinatlas.org/16533/36339_A_3_8.jpg Urothelial cancer Tumor cells medium not detected Male 78 1774 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_4_3.jpg http://images.proteinatlas.org/16533/36340_A_4_4.jpg Male 66 1824 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_5_1.jpg http://images.proteinatlas.org/16533/36340_A_5_2.jpg Female 85 1871 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_6_1.jpg http://images.proteinatlas.org/16533/36340_A_6_2.jpg Female 80 2031 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_5_3.jpg http://images.proteinatlas.org/16533/36340_A_5_4.jpg Male 51 2053 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_6_7.jpg http://images.proteinatlas.org/16533/36340_A_6_8.jpg Female 64 3002 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_6_5.jpg http://images.proteinatlas.org/16533/36340_A_6_6.jpg Female 56 3077 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/16533/36340_A_6_4.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/16533/36340_A_4_1.jpg http://images.proteinatlas.org/16533/36340_A_4_2.jpg IGLJ1 Intracellular, Secreted (different isoforms) Low cancer specificity Detected in some Breast cancer Lung cancer Stomach cancer Testis cancer intestine lymphoid tissue salivary gland stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi U-266/70 U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Not detected IGLJ2 Intracellular Group enriched (colorectal cancer, endometrial cancer) Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Head and neck cancer Lung cancer Pancreatic cancer Stomach cancer Testis cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi HMC-1 RH-30 U-698 Detected in some RH-30 & LHCN-M2 - Muscle contraction A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Transcription Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in single Plasma cells - Humoral immune response IGLJ3 Intracellular Group enriched (colorectal cancer, endometrial cancer) Detected in some Colorectal cancer Endometrial cancer Lung cancer Stomach cancer Testis cancer intestine lymphoid tissue salivary gland stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta cerebral cortex Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi REH U-266/70 U-266/84 Detected in some U-266 - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many B-cells Plasma cells Detected in some B-cells - Immune response IGLV1-40 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta cerebral cortex Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi RPMI-8226 SH-SY5Y TIME Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGLV1-44 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi RPMI-8226 SCLC-21H U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGLV1-47 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter HL-60 RH-30 RPMI-8226 SCLC-21H SH-SY5Y U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGLV1-51 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue urinary bladder Detected in all B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in all Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter HEK 293 Detected in many HEK293 & PC-3 - Transcription regulation A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGLV2-11 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Karpas-707 U-266/70 U-266/84 Detected in some Karpas-707 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGLV2-23 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Karpas-707 Detected in some Karpas-707 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Unknown function Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in all Plasma cells Detected in some Plasma cells - Humoral immune response IGLV2-8 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter U-266/70 U-266/84 Detected in many U-266 - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in many B-cells - Unknown function Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in all Plasma cells Detected in some Plasma cells - Humoral immune response IGLV3-1 Secreted

approved Liver http://images.proteinatlas.org/3285/9574_A_8_4_rna_selected.jpg Colon http://images.proteinatlas.org/3285/9574_A_7_3_rna_selected.jpg Kidney http://images.proteinatlas.org/3285/9574_A_8_5_rna_selected.jpg Testis http://images.proteinatlas.org/3285/9574_A_5_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/3285/9574_A_8_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/3285/9574_B_8_5_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix not detected Glandular cells not detected Lymphoid tissue not detected Bone marrow not detected Hematopoietic cells not detected Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node not detected Germinal center cells not detected Non-germinal center cells not detected Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Spleen not detected Cells in red pulp not detected Cells in white pulp not detected Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis not detected Cells in seminiferous ducts not detected Leydig cells not detected Thyroid gland not detected Glandular cells not detected Tonsil not detected Germinal center cells not detected Non-germinal center cells not detected Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi RPMI-8226 SCLC-21H SH-SY5Y Detected in some NB-4 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAH

approved No tissue staining or RNA expression data available for comparison Not done http://images.proteinatlas.org/3285/ihc_selected.jpg Adipose tissue Adipocytes low weak 75%-25% cytoplasmic/membranous Male 41 1700 http://images.proteinatlas.org/3285/9574_B_3_7.jpg Female 68 1970 http://images.proteinatlas.org/3285/9574_B_1_7.jpg Male 26 1995 http://images.proteinatlas.org/3285/9574_B_2_8.jpg Female 56 2336 http://images.proteinatlas.org/3285/9574_B_1_8.jpg Adrenal gland Glandular cells not detected weak <25% cytoplasmic/membranous Female 71 1966 http://images.proteinatlas.org/3285/9574_B_6_5.jpg Male 35 2212 http://images.proteinatlas.org/3285/9574_B_4_5.jpg Appendix Glandular cells low moderate <25% cytoplasmic/membranous Lymphoid tissue low moderate <25% cytoplasmic/membranous Male 38 2068 http://images.proteinatlas.org/3285/9574_A_3_2.jpg Female 66 2154 http://images.proteinatlas.org/3285/9574_A_1_2.jpg Bone marrow Hematopoietic cells medium strong <25% cytoplasmic/membranous Male 76 2682 http://images.proteinatlas.org/3285/9574_B_6_4.jpg Male 86 3100 http://images.proteinatlas.org/3285/9574_B_5_4.jpg Breast Adipocytes not detected negative none none Glandular cells low weak 75%-25% cytoplasmic/membranous Myoepithelial cells not detected negative none none Female 75 2042 http://images.proteinatlas.org/3285/9574_B_2_4.jpg Bronchus Respiratory epithelial cells low weak >75% cytoplasmic/membranous Female 49 2268 http://images.proteinatlas.org/3285/9574_B_5_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/3285/9574_B_7_7.jpg Female 54 2523 http://images.proteinatlas.org/3285/9574_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/3285/9574_B_9_7.jpg Cerebellum Cells in granular layer low weak >75% cytoplasmic/membranous Cells in molecular layer not detected negative none none Purkinje cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/3285/9574_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/3285/9574_B_8_8.jpg Female 19 2524 http://images.proteinatlas.org/3285/9574_B_9_8.jpg Cerebral cortex Endothelial cells not detected negative none none Glial cells low weak 75%-25% cytoplasmic/membranous Neuronal cells not detected negative none none Neuropil low weak >75% cytoplasmic/membranous Female 45 1539 http://images.proteinatlas.org/3285/9574_B_7_5.jpg Male 45 2521 http://images.proteinatlas.org/3285/9574_B_8_5.jpg Female 54 2523 http://images.proteinatlas.org/3285/9574_B_9_5.jpg Cervix Glandular cells low weak >75% cytoplasmic/membranous Female 55 2005 http://images.proteinatlas.org/3285/9574_B_7_3.jpg Colon Endothelial cells low weak 75%-25% cytoplasmic/membranous Glandular cells low weak >75% cytoplasmic/membranous Female 61 1832 http://images.proteinatlas.org/3285/9574_A_9_3.jpg Male 14 1990 http://images.proteinatlas.org/3285/9574_A_8_3.jpg Male 67 2404 http://images.proteinatlas.org/3285/9574_A_7_3.jpg Duodenum Glandular cells low weak 75%-25% cytoplasmic/membranous Male 50 1904 http://images.proteinatlas.org/3285/9574_A_7_2.jpg Male 66 2329 http://images.proteinatlas.org/3285/9574_A_9_2.jpg Female 64 2338 http://images.proteinatlas.org/3285/9574_A_8_2.jpg Endometrium 1 Cells in endometrial stroma not detected weak <25% cytoplasmic/membranous Glandular cells low weak 75%-25% cytoplasmic/membranous Female 27 2004 http://images.proteinatlas.org/3285/9574_B_6_3.jpg Female 42 2242 http://images.proteinatlas.org/3285/9574_B_4_3.jpg Female 33 2361 http://images.proteinatlas.org/3285/9574_B_5_3.jpg Endometrium 2 Cells in endometrial stroma not detected negative none none Glandular cells not detected weak <25% cytoplasmic/membranous Female 57 2102 http://images.proteinatlas.org/3285/9574_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 36 1740 http://images.proteinatlas.org/3285/9574_A_1_6.jpg Male 26 1995 http://images.proteinatlas.org/3285/9574_A_3_6.jpg Esophagus Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Male 62 2142 http://images.proteinatlas.org/3285/9574_B_6_1.jpg Fallopian tube Glandular cells not detected negative none none Female 29 1830 http://images.proteinatlas.org/3285/9574_A_7_7.jpg Female 33 2394 http://images.proteinatlas.org/3285/9574_A_8_7.jpg Gallbladder Glandular cells low weak 75%-25% cytoplasmic/membranous Female 63 2201 http://images.proteinatlas.org/3285/9574_A_5_4.jpg Female 24 2381 http://images.proteinatlas.org/3285/9574_A_4_4.jpg Male 65 2414 http://images.proteinatlas.org/3285/9574_A_6_4.jpg Heart muscle Cardiomyocytes not detected negative none none Male 45 2521 http://images.proteinatlas.org/3285/9574_B_6_6.jpg Female 54 2523 http://images.proteinatlas.org/3285/9574_B_4_6.jpg Female 19 2524 http://images.proteinatlas.org/3285/9574_B_5_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/3285/9574_B_8_6.jpg Female 54 2523 http://images.proteinatlas.org/3285/9574_B_9_6.jpg Female 19 2524 http://images.proteinatlas.org/3285/9574_B_7_6.jpg Kidney Cells in glomeruli not detected negative none none Cells in tubules low weak 75%-25% cytoplasmic/membranous Female 56 1933 http://images.proteinatlas.org/3285/9574_A_9_5.jpg Male 28 1943 http://images.proteinatlas.org/3285/9574_A_7_5.jpg Male 7 2165 http://images.proteinatlas.org/3285/9574_A_8_5.jpg Liver Cholangiocytes not detected negative none none Hepatocytes low weak 75%-25% cytoplasmic/membranous Male 67 1720 http://images.proteinatlas.org/3285/9574_A_8_4.jpg Female 32 1846 http://images.proteinatlas.org/3285/9574_A_7_4.jpg Female 29 1899 http://images.proteinatlas.org/3285/9574_A_9_4.jpg Lung Alveolar cells low weak 75%-25% cytoplasmic/membranous Macrophages low weak 75%-25% cytoplasmic/membranous Female 49 2268 http://images.proteinatlas.org/3285/9574_A_2_4.jpg Male 69 2373 http://images.proteinatlas.org/3285/9574_A_1_4.jpg Male 59 2417 http://images.proteinatlas.org/3285/9574_A_3_4.jpg Lymph node Germinal center cells medium strong <25% cytoplasmic/membranous Non-germinal center cells low moderate <25% cytoplasmic/membranous Male 8 1636 http://images.proteinatlas.org/3285/9574_A_8_8.jpg Male 46 2371 http://images.proteinatlas.org/3285/9574_A_7_8.jpg Nasopharynx Respiratory epithelial cells low weak >75% cytoplasmic/membranous Male 48 2402 http://images.proteinatlas.org/3285/9574_B_7_2.jpg Oral mucosa Squamous epithelial cells low weak 75%-25% cytoplasmic/membranous Male 62 1505 http://images.proteinatlas.org/3285/9574_A_7_1.jpg Male 71 1711 http://images.proteinatlas.org/3285/9574_A_9_1.jpg Female 84 2406 http://images.proteinatlas.org/3285/9574_A_8_1.jpg Ovary Follicle cells low weak 75%-25% cytoplasmic/membranous Ovarian stroma cells not detected negative none none Female 33 2159 http://images.proteinatlas.org/3285/9574_A_4_7.jpg Female 60 2264 http://images.proteinatlas.org/3285/9574_A_5_7.jpg Female 35 2344 http://images.proteinatlas.org/3285/9574_A_6_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/3285/9574_A_1_3.jpg Female 43 2220 http://images.proteinatlas.org/3285/9574_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/3285/9574_A_2_3.jpg Parathyroid gland Glandular cells low weak 75%-25% cytoplasmic/membranous Male 25 3371 http://images.proteinatlas.org/3285/9574_A_2_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells low weak >75% cytoplasmic/membranous Female 35 1814 http://images.proteinatlas.org/3285/9574_A_2_7.jpg Female 19 2169 http://images.proteinatlas.org/3285/9574_A_1_7.jpg Female 30 2515 http://images.proteinatlas.org/3285/9574_A_3_7.jpg Prostate Glandular cells low weak >75% cytoplasmic/membranous Male 64 1938 http://images.proteinatlas.org/3285/9574_A_3_5.jpg Male 51 2053 http://images.proteinatlas.org/3285/9574_A_1_5.jpg Male 60 2098 http://images.proteinatlas.org/3285/9574_A_2_5.jpg Rectum Glandular cells low weak >75% cytoplasmic/membranous Female 46 1876 http://images.proteinatlas.org/3285/9574_A_6_3.jpg Male 92 2001 http://images.proteinatlas.org/3285/9574_A_4_3.jpg Salivary gland Glandular cells low weak 75%-25% cytoplasmic/membranous Male 8 1636 http://images.proteinatlas.org/3285/9574_B_2_1.jpg Male 54 1682 http://images.proteinatlas.org/3285/9574_B_3_1.jpg Female 24 2323 http://images.proteinatlas.org/3285/9574_B_1_1.jpg Skeletal muscle Myocytes not detected weak <25% nuclear Male 62 1505 http://images.proteinatlas.org/3285/9574_B_3_6.jpg Female 58 2148 http://images.proteinatlas.org/3285/9574_B_2_6.jpg Skin 1 Fibroblasts low weak >75% cytoplasmic/membranous Keratinocytes low weak >75% cytoplasmic/membranous Langerhans low weak >75% cytoplasmic/membranous Melanocytes medium moderate >75% cytoplasmic/membranous Male 63 2418 http://images.proteinatlas.org/3285/9574_B_8_1.jpg Skin 2 Epidermal cells not detected weak <25% cytoplasmic/membranous Female 68 1970 http://images.proteinatlas.org/3285/9574_B_4_8.jpg Female 15 2027 http://images.proteinatlas.org/3285/9574_B_5_8.jpg Small intestine Glandular cells low weak 75%-25% cytoplasmic/membranous Male 41 2226 http://images.proteinatlas.org/3285/9574_A_5_2.jpg Male 71 2411 http://images.proteinatlas.org/3285/9574_A_6_2.jpg Smooth muscle Smooth muscle cells not detected negative none none Female 39 2225 http://images.proteinatlas.org/3285/9574_B_4_7.jpg Male 67 2404 http://images.proteinatlas.org/3285/9574_B_6_7.jpg Female 65 2434 http://images.proteinatlas.org/3285/9574_B_5_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Male 26 1995 http://images.proteinatlas.org/3285/9574_B_2_8.jpg Female 56 2336 http://images.proteinatlas.org/3285/9574_B_1_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve not detected negative none none Male 41 1700 http://images.proteinatlas.org/3285/9574_B_3_7.jpg Female 68 1970 http://images.proteinatlas.org/3285/9574_B_1_7.jpg Spleen Cells in red pulp low moderate <25% cytoplasmic/membranous Cells in white pulp low moderate <25% cytoplasmic/membranous Male 72 1714 http://images.proteinatlas.org/3285/9574_B_7_4.jpg Female 10 1905 http://images.proteinatlas.org/3285/9574_B_9_4.jpg Female 43 2220 http://images.proteinatlas.org/3285/9574_B_8_4.jpg Stomach 1 Glandular cells low weak 75%-25% cytoplasmic/membranous Male 76 2066 http://images.proteinatlas.org/3285/9574_A_4_1.jpg Female 56 2130 http://images.proteinatlas.org/3285/9574_A_5_1.jpg Male 68 2471 http://images.proteinatlas.org/3285/9574_A_6_1.jpg Stomach 2 Glandular cells not detected weak <25% cytoplasmic/membranous Female 65 2326 http://images.proteinatlas.org/3285/9574_A_2_1.jpg Male 59 2378 http://images.proteinatlas.org/3285/9574_A_3_1.jpg Male 71 2411 http://images.proteinatlas.org/3285/9574_A_1_1.jpg Testis Cells in seminiferous ducts not detected negative none none Leydig cells low weak 75%-25% cytoplasmic/membranous Male 68 1880 http://images.proteinatlas.org/3285/9574_A_5_6.jpg Male 26 2071 http://images.proteinatlas.org/3285/9574_A_4_6.jpg Male 46 2435 http://images.proteinatlas.org/3285/9574_A_6_6.jpg Thyroid gland Glandular cells low weak 75%-25% cytoplasmic/membranous Male 61 2072 http://images.proteinatlas.org/3285/9574_B_2_5.jpg Female 22 2146 http://images.proteinatlas.org/3285/9574_B_1_5.jpg Female 33 2219 http://images.proteinatlas.org/3285/9574_B_3_5.jpg Tonsil Germinal center cells not detected weak <25% cytoplasmic/membranous Non-germinal center cells high strong 75%-25% cytoplasmic/membranous,nuclear Squamous epithelial cells not detected negative none none Female 40 2250 http://images.proteinatlas.org/3285/9574_A_4_8.jpg Male 31 2511 http://images.proteinatlas.org/3285/9574_A_6_8.jpg Male 20 2519 http://images.proteinatlas.org/3285/9574_A_5_8.jpg Urinary bladder Urothelial cells low weak 75%-25% cytoplasmic/membranous Female 80 1921 http://images.proteinatlas.org/3285/9574_A_5_5.jpg Male 51 2053 http://images.proteinatlas.org/3285/9574_A_4_5.jpg Male 48 2472 http://images.proteinatlas.org/3285/9574_A_6_5.jpg Vagina Squamous epithelial cells not detected weak <25% cytoplasmic/membranous Female 34 1751 http://images.proteinatlas.org/3285/9574_B_1_2.jpg Female 46 1762 http://images.proteinatlas.org/3285/9574_B_2_2.jpg Female 68 1829 http://images.proteinatlas.org/3285/9574_B_3_2.jpg

Breast cancer Tumor cells low not detected Female 40 1838 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_5_1.jpg Female 80 1874 Not detected Negative None none http://images.proteinatlas.org/3285/9571_A_6_1.jpg http://images.proteinatlas.org/3285/9571_A_6_2.jpg Female 61 1910 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_6_7.jpg http://images.proteinatlas.org/3285/9571_A_6_8.jpg Female 87 1939 Not detected Negative None none http://images.proteinatlas.org/3285/9571_A_6_5.jpg Female 50 1977 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_5_7.jpg http://images.proteinatlas.org/3285/9571_A_5_8.jpg Female 49 2015 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_5_3.jpg http://images.proteinatlas.org/3285/9571_A_5_4.jpg Female 51 2073 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_5_5.jpg http://images.proteinatlas.org/3285/9571_A_5_6.jpg Female 51 2083 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_4_3.jpg http://images.proteinatlas.org/3285/9571_A_4_4.jpg Female 40 2091 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_4_5.jpg http://images.proteinatlas.org/3285/9571_A_4_6.jpg Female 60 2199 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_4_7.jpg http://images.proteinatlas.org/3285/9571_A_4_8.jpg Female 27 2392 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_6_4.jpg Female 41 2898 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_4_1.jpg http://images.proteinatlas.org/3285/9571_A_4_2.jpg Carcinoid Tumor cells low not detected Male 60 1425 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_1_3.jpg http://images.proteinatlas.org/3285/9572_A_1_4.jpg Female 54 2088 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_1_5.jpg http://images.proteinatlas.org/3285/9572_A_1_6.jpg Female 51 2467 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_1_2.jpg Male 41 2618 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_1_7.jpg http://images.proteinatlas.org/3285/9572_A_1_8.jpg Cervical cancer Tumor cells low not detected Female 39 30 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_6_1.jpg http://images.proteinatlas.org/3285/9571_B_6_2.jpg Female 27 608 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_4_1.jpg http://images.proteinatlas.org/3285/9571_B_4_2.jpg Female 57 687 Not detected Negative None none http://images.proteinatlas.org/3285/9571_B_6_7.jpg http://images.proteinatlas.org/3285/9571_B_6_8.jpg Female 40 978 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_6_3.jpg http://images.proteinatlas.org/3285/9571_B_6_4.jpg Female 53 1004 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_6_5.jpg http://images.proteinatlas.org/3285/9571_B_6_6.jpg Female 33 1256 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_5_7.jpg http://images.proteinatlas.org/3285/9571_B_5_8.jpg Female 34 1751 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_5_1.jpg http://images.proteinatlas.org/3285/9571_B_5_2.jpg Female 64 2237 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_4_7.jpg http://images.proteinatlas.org/3285/9571_B_4_8.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/3285/9571_B_5_5.jpg http://images.proteinatlas.org/3285/9571_B_5_6.jpg Colorectal cancer Tumor cells low not detected Male 55 349 Not detected Negative None none http://images.proteinatlas.org/3285/9571_A_1_3.jpg http://images.proteinatlas.org/3285/9571_A_1_4.jpg Male 71 1898 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_2_3.jpg http://images.proteinatlas.org/3285/9571_A_2_4.jpg Female 84 1958 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_1_5.jpg http://images.proteinatlas.org/3285/9571_A_1_6.jpg Male 14 1990 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_2_7.jpg http://images.proteinatlas.org/3285/9571_A_2_8.jpg Male 92 2001 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_2_1.jpg http://images.proteinatlas.org/3285/9571_A_2_2.jpg Male 82 2002 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_1_7.jpg http://images.proteinatlas.org/3285/9571_A_1_8.jpg Female 78 2045 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_3_5.jpg http://images.proteinatlas.org/3285/9571_A_3_6.jpg Female 66 2060 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_3_7.jpg http://images.proteinatlas.org/3285/9571_A_3_8.jpg Male 72 2096 Not detected Negative None none http://images.proteinatlas.org/3285/9571_A_3_3.jpg http://images.proteinatlas.org/3285/9571_A_3_4.jpg Female 86 2106 Not detected Negative None none http://images.proteinatlas.org/3285/9571_A_1_2.jpg Female 77 2468 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_3_1.jpg http://images.proteinatlas.org/3285/9571_A_3_2.jpg Female 57 2619 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_2_5.jpg Endometrial cancer Tumor cells medium low not detected Female 42 1102 Not detected Weak <25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_B_9_5.jpg http://images.proteinatlas.org/3285/9571_B_9_6.jpg Female 66 1164 Not detected Weak <25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_B_9_7.jpg http://images.proteinatlas.org/3285/9571_B_9_8.jpg Female 83 1750 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_B_8_5.jpg http://images.proteinatlas.org/3285/9571_B_8_6.jpg Female 53 1766 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_8_7.jpg http://images.proteinatlas.org/3285/9571_B_8_8.jpg Female 86 1881 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_B_9_1.jpg http://images.proteinatlas.org/3285/9571_B_9_2.jpg Female 74 1963 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_8_1.jpg http://images.proteinatlas.org/3285/9571_B_8_2.jpg Female 67 2113 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_B_7_5.jpg http://images.proteinatlas.org/3285/9571_B_7_6.jpg Female 70 2118 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_7_1.jpg http://images.proteinatlas.org/3285/9571_B_7_2.jpg Female 59 2122 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_B_7_3.jpg http://images.proteinatlas.org/3285/9571_B_7_4.jpg Female 75 2173 Not detected Negative None none http://images.proteinatlas.org/3285/9571_B_8_3.jpg http://images.proteinatlas.org/3285/9571_B_8_4.jpg Female 69 2236 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_7_7.jpg http://images.proteinatlas.org/3285/9571_B_7_8.jpg Female 79 2339 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_B_9_3.jpg http://images.proteinatlas.org/3285/9571_B_9_4.jpg Glioma Tumor cells low not detected Male 77 1537 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_5_7.jpg http://images.proteinatlas.org/3285/9572_A_5_8.jpg Male 75 1548 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9572_A_5_5.jpg http://images.proteinatlas.org/3285/9572_A_5_6.jpg Female 55 1572 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_4_1.jpg http://images.proteinatlas.org/3285/9572_A_4_2.jpg Male 56 1578 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_4_5.jpg http://images.proteinatlas.org/3285/9572_A_4_6.jpg Male 76 1589 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_4_7.jpg http://images.proteinatlas.org/3285/9572_A_4_8.jpg Female 10 1599 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_5_1.jpg http://images.proteinatlas.org/3285/9572_A_5_2.jpg Male 33 1627 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_6_3.jpg http://images.proteinatlas.org/3285/9572_A_6_4.jpg Female 59 1645 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_6_7.jpg http://images.proteinatlas.org/3285/9572_A_6_8.jpg Male 60 2726 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_6_1.jpg http://images.proteinatlas.org/3285/9572_A_6_2.jpg Male 47 2750 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_6_5.jpg http://images.proteinatlas.org/3285/9572_A_6_6.jpg Male 42 2878 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_5_3.jpg http://images.proteinatlas.org/3285/9572_A_5_4.jpg Head and neck cancer Tumor cells low not detected Female 76 298 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9572_A_2_1.jpg http://images.proteinatlas.org/3285/9572_A_2_2.jpg Male 43 2358 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_2_3.jpg Female 84 2406 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_2_7.jpg http://images.proteinatlas.org/3285/9572_A_2_8.jpg Male 80 2606 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_2_5.jpg http://images.proteinatlas.org/3285/9572_A_2_6.jpg Liver cancer Tumor cells medium low not detected Male 70 879 Not detected Negative None none http://images.proteinatlas.org/3285/9573_B_9_3.jpg http://images.proteinatlas.org/3285/9573_B_9_4.jpg Female 79 1022 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_8_1.jpg http://images.proteinatlas.org/3285/9573_B_8_2.jpg Male 57 1175 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_8_3.jpg http://images.proteinatlas.org/3285/9573_B_8_4.jpg Female 55 1252 Not detected Negative None none http://images.proteinatlas.org/3285/9573_B_7_8.jpg Female 73 2279 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_7_5.jpg http://images.proteinatlas.org/3285/9573_B_7_6.jpg Male 80 2280 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_9_1.jpg http://images.proteinatlas.org/3285/9573_B_9_2.jpg Male 76 2325 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_8_5.jpg http://images.proteinatlas.org/3285/9573_B_8_6.jpg Female 52 2399 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_7_3.jpg http://images.proteinatlas.org/3285/9573_B_7_4.jpg Male 72 2556 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_8_8.jpg Lung cancer Tumor cells low not detected Female 58 1235 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_1_3.jpg http://images.proteinatlas.org/3285/9572_B_1_4.jpg Male 84 1394 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_3_7.jpg http://images.proteinatlas.org/3285/9572_B_3_8.jpg Female 76 1421 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_2_2.jpg Female 67 1435 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_1_8.jpg Male 54 1727 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_2_3.jpg http://images.proteinatlas.org/3285/9572_B_2_4.jpg Male 64 1847 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_3_5.jpg http://images.proteinatlas.org/3285/9572_B_3_6.jpg Female 51 2041 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_3_1.jpg http://images.proteinatlas.org/3285/9572_B_3_2.jpg Male 66 2050 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_2_5.jpg http://images.proteinatlas.org/3285/9572_B_2_6.jpg Female 47 2100 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_1_5.jpg http://images.proteinatlas.org/3285/9572_B_1_6.jpg Male 71 2231 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_2_7.jpg http://images.proteinatlas.org/3285/9572_B_2_8.jpg Female 65 2403 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_3_3.jpg http://images.proteinatlas.org/3285/9572_B_3_4.jpg Female 64 2438 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_1_2.jpg Lymphoma Tumor cells low not detected Male 73 205 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_8_3.jpg http://images.proteinatlas.org/3285/9572_A_8_4.jpg Male 65 226 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_9_3.jpg http://images.proteinatlas.org/3285/9572_A_9_4.jpg Male 60 408 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_9_1.jpg http://images.proteinatlas.org/3285/9572_A_9_2.jpg Male 92 1472 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_8_1.jpg http://images.proteinatlas.org/3285/9572_A_8_2.jpg Female 50 1596 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_7_7.jpg http://images.proteinatlas.org/3285/9572_A_7_8.jpg Male 70 1598 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_8_5.jpg http://images.proteinatlas.org/3285/9572_A_8_6.jpg Female 36 1606 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_7_5.jpg http://images.proteinatlas.org/3285/9572_A_7_6.jpg Female 76 1618 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_8_7.jpg Female 73 2207 Not detected Negative None none http://images.proteinatlas.org/3285/9572_A_7_1.jpg http://images.proteinatlas.org/3285/9572_A_7_2.jpg Female 84 2256 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_7_3.jpg http://images.proteinatlas.org/3285/9572_A_7_4.jpg Male 18 2604 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_9_7.jpg http://images.proteinatlas.org/3285/9572_A_9_8.jpg Female 67 2751 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_9_5.jpg http://images.proteinatlas.org/3285/9572_A_9_6.jpg Melanoma Tumor cells low not detected Female 56 1220 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_5_3.jpg http://images.proteinatlas.org/3285/9572_B_5_4.jpg Male 59 1414 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_6_6.jpg Male 61 1482 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_6_7.jpg http://images.proteinatlas.org/3285/9572_B_6_8.jpg Female 52 1560 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_6_3.jpg http://images.proteinatlas.org/3285/9572_B_6_4.jpg Male 41 2112 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_5_7.jpg http://images.proteinatlas.org/3285/9572_B_5_8.jpg Female 87 2136 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_4_5.jpg http://images.proteinatlas.org/3285/9572_B_4_6.jpg Male 41 2246 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_5_1.jpg http://images.proteinatlas.org/3285/9572_B_5_2.jpg Male 64 2317 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_6_1.jpg http://images.proteinatlas.org/3285/9572_B_6_2.jpg Male 53 2534 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_4_1.jpg http://images.proteinatlas.org/3285/9572_B_4_2.jpg Female 30 2598 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_5_5.jpg http://images.proteinatlas.org/3285/9572_B_5_6.jpg Female 21 2799 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_4_3.jpg http://images.proteinatlas.org/3285/9572_B_4_4.jpg Ovarian cancer Tumor cells medium low not detected Female 37 857 Not detected Negative None none http://images.proteinatlas.org/3285/9571_B_2_5.jpg http://images.proteinatlas.org/3285/9571_B_2_6.jpg Female 36 1310 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_2_7.jpg http://images.proteinatlas.org/3285/9571_B_2_8.jpg Female 82 1401 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_1_7.jpg http://images.proteinatlas.org/3285/9571_B_1_8.jpg Female 50 1658 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_3_3.jpg http://images.proteinatlas.org/3285/9571_B_3_4.jpg Female 73 1844 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_2_3.jpg http://images.proteinatlas.org/3285/9571_B_2_4.jpg Female 56 2021 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_1_3.jpg http://images.proteinatlas.org/3285/9571_B_1_4.jpg Female 57 2082 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_2_1.jpg http://images.proteinatlas.org/3285/9571_B_2_2.jpg Female 54 2114 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_1_5.jpg http://images.proteinatlas.org/3285/9571_B_1_6.jpg Female 66 2149 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_1_1.jpg http://images.proteinatlas.org/3285/9571_B_1_2.jpg Female 42 2218 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_3_7.jpg http://images.proteinatlas.org/3285/9571_B_3_8.jpg Female 71 2362 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_3_1.jpg http://images.proteinatlas.org/3285/9571_B_3_2.jpg Female 62 2384 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_B_3_5.jpg Pancreatic cancer Tumor cells medium low not detected Female 73 365 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_4_5.jpg http://images.proteinatlas.org/3285/9573_B_4_6.jpg Male 70 402 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_6_1.jpg http://images.proteinatlas.org/3285/9573_B_6_2.jpg Female 64 646 Not detected Negative None none http://images.proteinatlas.org/3285/9573_B_6_3.jpg http://images.proteinatlas.org/3285/9573_B_6_4.jpg Female 60 875 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_4_3.jpg http://images.proteinatlas.org/3285/9573_B_4_4.jpg Female 57 977 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_5_5.jpg http://images.proteinatlas.org/3285/9573_B_5_6.jpg Male 82 1099 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_5_7.jpg http://images.proteinatlas.org/3285/9573_B_5_8.jpg Male 77 1248 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_4_7.jpg http://images.proteinatlas.org/3285/9573_B_4_8.jpg Male 63 1647 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_4_1.jpg http://images.proteinatlas.org/3285/9573_B_4_2.jpg Male 50 1904 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_6_5.jpg Female 64 2338 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_5_3.jpg http://images.proteinatlas.org/3285/9573_B_5_4.jpg Male 79 2650 Not detected Negative None none http://images.proteinatlas.org/3285/9573_B_5_2.jpg Prostate cancer Tumor cells low not detected Male 71 79 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_8_3.jpg Male 64 250 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_A_9_5.jpg http://images.proteinatlas.org/3285/9571_A_9_6.jpg Male 63 472 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_8_5.jpg http://images.proteinatlas.org/3285/9571_A_8_6.jpg Male 59 1052 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_A_9_3.jpg http://images.proteinatlas.org/3285/9571_A_9_4.jpg Male 85 2824 Not detected Negative None none http://images.proteinatlas.org/3285/9571_A_9_7.jpg Male 72 3190 Low Weak 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/3285/9571_A_9_1.jpg http://images.proteinatlas.org/3285/9571_A_9_2.jpg Male 70 3191 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_8_7.jpg http://images.proteinatlas.org/3285/9571_A_8_8.jpg Male 73 3301 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_7_3.jpg http://images.proteinatlas.org/3285/9571_A_7_4.jpg Male 58 3302 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_7_5.jpg http://images.proteinatlas.org/3285/9571_A_7_6.jpg Male 58 3303 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_7_7.jpg http://images.proteinatlas.org/3285/9571_A_7_8.jpg Male 61 3304 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9571_A_8_1.jpg http://images.proteinatlas.org/3285/9571_A_8_2.jpg Renal cancer Tumor cells medium low not detected Female 83 1352 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_7_3.jpg Female 60 1722 Not detected Negative None none http://images.proteinatlas.org/3285/9573_A_7_1.jpg http://images.proteinatlas.org/3285/9573_A_7_2.jpg Male 46 1741 Not detected Negative None none http://images.proteinatlas.org/3285/9573_A_7_7.jpg http://images.proteinatlas.org/3285/9573_A_7_8.jpg Male 56 1752 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_8_1.jpg http://images.proteinatlas.org/3285/9573_A_8_2.jpg Male 68 1786 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_8_3.jpg http://images.proteinatlas.org/3285/9573_A_8_4.jpg Male 77 1831 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_8_5.jpg http://images.proteinatlas.org/3285/9573_A_8_6.jpg Male 61 1859 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_8_7.jpg http://images.proteinatlas.org/3285/9573_A_8_8.jpg Female 56 1933 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_9_5.jpg http://images.proteinatlas.org/3285/9573_A_9_6.jpg Male 63 1969 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_9_1.jpg http://images.proteinatlas.org/3285/9573_A_9_2.jpg Male 71 2034 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_9_4.jpg Female 72 2067 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_7_5.jpg http://images.proteinatlas.org/3285/9573_A_7_6.jpg Skin cancer Tumor cells low not detected Male 24 1693 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_7_1.jpg http://images.proteinatlas.org/3285/9572_B_7_2.jpg Male 65 1861 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_7_3.jpg Female 83 2150 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_8_3.jpg http://images.proteinatlas.org/3285/9572_B_8_4.jpg Male 87 2166 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_7_5.jpg http://images.proteinatlas.org/3285/9572_B_7_6.jpg Female 59 2343 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_8_1.jpg http://images.proteinatlas.org/3285/9572_B_8_2.jpg Female 71 2423 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_9_1.jpg Male 63 2437 Not detected Negative None none http://images.proteinatlas.org/3285/9572_B_9_4.jpg Male 87 2548 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_9_5.jpg http://images.proteinatlas.org/3285/9572_B_9_6.jpg Female 57 2554 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_8_8.jpg Female 42 2609 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_B_7_7.jpg http://images.proteinatlas.org/3285/9572_B_7_8.jpg Stomach cancer Tumor cells medium low not detected Female 93 360 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_3_7.jpg http://images.proteinatlas.org/3285/9573_B_3_8.jpg Female 72 1042 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_3_3.jpg http://images.proteinatlas.org/3285/9573_B_3_4.jpg Female 71 1061 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_1_5.jpg http://images.proteinatlas.org/3285/9573_B_1_6.jpg Female 75 1534 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_2_1.jpg http://images.proteinatlas.org/3285/9573_B_2_2.jpg Male 82 1787 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_1_1.jpg http://images.proteinatlas.org/3285/9573_B_1_2.jpg Male 76 2066 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_1_3.jpg http://images.proteinatlas.org/3285/9573_B_1_4.jpg Male 62 2105 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_1_7.jpg http://images.proteinatlas.org/3285/9573_B_1_8.jpg Male 62 2142 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_2_7.jpg http://images.proteinatlas.org/3285/9573_B_2_8.jpg Male 48 2195 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_3_1.jpg http://images.proteinatlas.org/3285/9573_B_3_2.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/3285/9573_B_2_5.jpg http://images.proteinatlas.org/3285/9573_B_2_6.jpg Male 59 2378 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_3_5.jpg http://images.proteinatlas.org/3285/9573_B_3_6.jpg Male 59 2473 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_B_2_3.jpg http://images.proteinatlas.org/3285/9573_B_2_4.jpg Testis cancer Tumor cells medium low not detected Male 52 138 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_3_1.jpg http://images.proteinatlas.org/3285/9573_A_3_2.jpg Male 39 411 Not detected Negative None none http://images.proteinatlas.org/3285/9573_A_1_7.jpg http://images.proteinatlas.org/3285/9573_A_1_8.jpg Male 28 1179 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_1_3.jpg http://images.proteinatlas.org/3285/9573_A_1_4.jpg Male 21 1340 Not detected Negative None none http://images.proteinatlas.org/3285/9573_A_3_3.jpg http://images.proteinatlas.org/3285/9573_A_3_4.jpg Male 41 1700 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_3_7.jpg http://images.proteinatlas.org/3285/9573_A_3_8.jpg Male 36 1740 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_3_5.jpg http://images.proteinatlas.org/3285/9573_A_3_6.jpg Male 43 1777 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_2_7.jpg http://images.proteinatlas.org/3285/9573_A_2_8.jpg Male 71 1818 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_2_5.jpg http://images.proteinatlas.org/3285/9573_A_2_6.jpg Male 59 1900 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_2_3.jpg http://images.proteinatlas.org/3285/9573_A_2_4.jpg Male 26 1995 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_2_1.jpg http://images.proteinatlas.org/3285/9573_A_2_2.jpg Male 26 2071 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_1_6.jpg Male 19 2116 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_1_2.jpg Thyroid cancer Tumor cells low not detected Male 20 688 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_3_1.jpg http://images.proteinatlas.org/3285/9572_A_3_2.jpg Female 35 1014 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_3_3.jpg http://images.proteinatlas.org/3285/9572_A_3_4.jpg Male 77 2623 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9572_A_3_5.jpg http://images.proteinatlas.org/3285/9572_A_3_6.jpg Urothelial cancer Tumor cells low not detected Female 84 267 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_6_1.jpg http://images.proteinatlas.org/3285/9573_A_6_2.jpg Female 81 662 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_5_3.jpg http://images.proteinatlas.org/3285/9573_A_5_4.jpg Male 86 944 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_5_7.jpg http://images.proteinatlas.org/3285/9573_A_5_8.jpg Male 78 1441 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_4_1.jpg http://images.proteinatlas.org/3285/9573_A_4_2.jpg Male 74 1651 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_4_3.jpg http://images.proteinatlas.org/3285/9573_A_4_4.jpg Male 50 1717 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_4_6.jpg Male 66 1824 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_5_2.jpg Female 85 1871 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_6_4.jpg Male 57 1906 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_4_7.jpg http://images.proteinatlas.org/3285/9573_A_4_8.jpg Male 61 1984 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_5_6.jpg Female 80 2031 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_6_7.jpg http://images.proteinatlas.org/3285/9573_A_6_8.jpg Female 75 2699 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/3285/9573_A_6_5.jpg http://images.proteinatlas.org/3285/9573_A_6_6.jpg supported http://v21.proteinatlas.org/images_protein_array/3285_medium.png IGLV3-19 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter RPMI-8226 SCLC-21H SH-SY5Y U-251 MG Detected in some SH-SY5Y - Nervous system development A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Transcription Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response IGLV3-21 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue urinary bladder Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in some Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter REH Detected in some REH - Unknown function A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGLV4-69 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue salivary gland stomach 1 urinary bladder Detected in many B-cells - Humoral immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta medulla oblongata Detected in single Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi NB-4 REH RPMI-8226 SH-SY5Y Detected in some RPMI-8226 - Immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in single Plasma cells Detected in some Plasma cells - Humoral immune response IGLV6-57 Secreted Low cancer specificity Detected in all Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer lymphoid tissue urinary bladder Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Daudi RPMI-8226 U-266/70 U-698 Detected in some U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in some Plasma cells - Humoral immune response POU2AF1 BOB1 OBF1 Intracellular

enhanced Liver http://images.proteinatlas.org/11193/27220_A_7_4_rna_selected.jpg Colon http://images.proteinatlas.org/11193/27220_A_7_3_rna_selected.jpg Kidney http://images.proteinatlas.org/11193/27220_A_7_5_rna_selected.jpg Testis http://images.proteinatlas.org/11193/27220_A_4_6_rna_selected.jpg Lymph node http://images.proteinatlas.org/11193/27220_A_7_8_rna_selected.jpg Cerebral cortex http://images.proteinatlas.org/11193/27284_B_8_5_rna_selected.jpg Tonsil http://images.proteinatlas.org/11193/27220_A_6_8_rna_selected.jpg Adipose tissue not detected Adipocytes not detected Adrenal gland not detected Glandular cells not detected Appendix high Glandular cells not detected Lymphoid tissue high Bone marrow medium Hematopoietic cells medium Breast not detected Adipocytes not detected Glandular cells not detected Myoepithelial cells not detected Bronchus not detected Respiratory epithelial cells not detected Caudate not detected Glial cells not detected Neuronal cells not detected Cerebellum not detected Cells in granular layer not detected Cells in molecular layer not detected Purkinje cells not detected Cerebral cortex not detected Endothelial cells not detected Glial cells not detected Neuronal cells not detected Neuropil not detected Cervix not detected Glandular cells not detected Squamous epithelial cells not detected Colon not detected Endothelial cells not detected Glandular cells not detected Peripheral nerve/ganglion not detected Duodenum not detected Glandular cells not detected Endometrium 1 not detected Cells in endometrial stroma not detected Glandular cells not detected Endometrium 2 not detected Cells in endometrial stroma not detected Glandular cells not detected Epididymis not detected Glandular cells not detected Esophagus not detected Squamous epithelial cells not detected Fallopian tube not detected Glandular cells not detected Gallbladder not detected Glandular cells not detected Heart muscle not detected Cardiomyocytes not detected Hippocampus not detected Glial cells not detected Neuronal cells not detected Kidney not detected Cells in glomeruli not detected Cells in tubules not detected Liver not detected Cholangiocytes not detected Hepatocytes not detected Lung not detected Alveolar cells not detected Macrophages not detected Lymph node high Germinal center cells high Non-germinal center cells medium Nasopharynx not detected Respiratory epithelial cells not detected Oral mucosa not detected Squamous epithelial cells not detected Ovary not detected Follicle cells not detected Ovarian stroma cells not detected Pancreas not detected Exocrine glandular cells not detected Pancreatic endocrine cells not detected Parathyroid gland not detected Glandular cells not detected Placenta not detected Decidual cells not detected Trophoblastic cells not detected Prostate not detected Glandular cells not detected Rectum not detected Glandular cells not detected Salivary gland not detected Glandular cells not detected Seminal vesicle not detected Glandular cells not detected Skeletal muscle not detected Myocytes not detected Skin 1 not detected Fibroblasts not detected Keratinocytes not detected Langerhans not detected Melanocytes not detected Skin 2 not detected Epidermal cells not detected Small intestine not detected Glandular cells not detected Smooth muscle not detected Smooth muscle cells not detected Soft tissue 1 not detected Chondrocytes not detected Fibroblasts not detected Peripheral nerve not detected Soft tissue 2 not detected Fibroblasts not detected Peripheral nerve not detected Spleen medium Cells in red pulp not detected Cells in white pulp medium Stomach 1 not detected Glandular cells not detected Stomach 2 not detected Glandular cells not detected Testis medium Elongated or late spermatids not detected Leydig cells medium Pachytene spermatocytes not detected Peritubular cells not detected Preleptotene spermatocytes not detected Round or early spermatids not detected Sertoli cells medium Spermatogonia cells not detected Thyroid gland not detected Glandular cells not detected Tonsil high Germinal center cells high Non-germinal center cells medium Squamous epithelial cells not detected Urinary bladder not detected Urothelial cells not detected Vagina not detected Squamous epithelial cells not detected Low cancer specificity Detected in many Breast cancer Cervical cancer Colorectal cancer Endometrial cancer Glioma Head and neck cancer Liver cancer Lung cancer Melanoma Ovarian cancer Pancreatic cancer Prostate cancer Renal cancer Stomach cancer Testis cancer Thyroid cancer Urothelial cancer intestine lymphoid tissue stomach 1 Detected in many Immune cells - Immune response Adipose tissue Adrenal gland Amygdala Appendix Basal ganglia Bone marrow Breast Cerebellum Cerebral cortex Cervix Choroid plexus Colon Duodenum Endometrium 1 Epididymis Esophagus Fallopian tube Gallbladder Heart muscle Hippocampal formation Hypothalamus Kidney Liver Lung Lymph node Medulla oblongata Midbrain Ovary Pancreas Parathyroid gland Pituitary gland Placenta Pons Prostate Rectum Retina Salivary gland Seminal vesicle Skeletal muscle Skin 1 Small intestine Smooth muscle Spinal cord Spleen Stomach 1 Testis Thalamus Thymus Thyroid gland Tongue Tonsil Urinary bladder Vagina White matter Adipose tissue Adrenal gland Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Appendix Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Bone marrow Breast Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Cervix Choroid plexus Claustrum Colon Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Duodenum Endometrium 1 Entorhinal gyrus Epididymis Esophagus Fallopian tube Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gallbladder Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Heart muscle Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kidney Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Liver Locus coeruleus Lung Lymph node Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Ovary Pancreas Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Parathyroid gland Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Placenta Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Prostate Pulvinar Putamen Rectum Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Salivary gland Seminal vesicle Septal nuclei Skeletal muscle Skin 1 Small intestine Smooth muscle Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Spleen Stomach 1 Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Testis Thymus Thyroid gland Tongue Tonsil Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Urinary bladder Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Amygdala Angular gyrus Angular gyrus (white matter) Anterior cingulate cortex, supragenual-dorsal Anterior cingulate cortex, supragenual-ventral Anterior cingulate gyrus, pregenual-dorsal Anterior cingulate gyrus, pregenual-ventral Anterior cingulate gyrus, subgenual Anterior cochlear nucleus, ventral Anterior funiculus (white matter) Anterior insular cortex, dorsal Anterior insular cortex, ventral Anterior thalamic nucleus, ventral Arcuate nucleus Area parastriata, inferior Area parastriata, parietal Area parastriata, superior Area parastriata, temporal Area postrema Area striata Area striata (white matter) Basal amygdala Caudate nucleus Central amygdala Centromedial thalamic nucleus Cerebellar cortex Cerebellar nuclei Cerebellar white matter Cervical spinal cord, central gray Cervical spinal cord, dorsal horn Cervical spinal cord, ventral horn Claustrum Corpus callosum, genu (white matter) Corpus callosum, splenium (white matter) Corticomedial amygdala Cuneate nuclei Cuneiform nucleus Dentate gyrus Dorsal cochlear nucleus Dorsal funiculus (white matter) Dorsal medullary reticular nucleus Dorsal motor vagal complex Dorsal raphe nucleus Dorsal tegmental nucleus Dorsolateral prefrontal cortex Dorsolateral tegmental area Dorsomedial nucleus Dorsomedial prefrontal cortex Entorhinal gyrus Flocculonodular lobe Frontal cortex Frontal eye field Frontal operculum Frontomarginal cortex Frontopolar cortex Fusiform gyrus Gigantocellular reticular nuclei, medullary Gigantocellular reticular nuclei, pars Globus pallidus, externus Globus pallidus, internus Gyrus rectus Habenula Hippocampus Hippocampus, CA1 Hippocampus, CA2 Hippocampus, CA3 Inferior colliculus Inferior frontal gyrus, opercular Inferior frontal gyrus, orbital Inferior frontal gyrus, triangular Inferior olive Inferior parietal lobule Inferior temporal gyrus Intraparietal deep sulcus Kolliker-Fuse nucleus Lateral amygdala Lateral funiculus (white matter) Lateral geniculate body Lateral hypothalamic area Lateral lemniscal nuclei Lateral medullary reticular nucleus Lateral parabrachial nucleus Lateral thalamic nuclei Lateral vestibular nucleus Lingual gyrus Locus coeruleus Mamillary body Medial dorsal thalamic nucleus Medial geniculate body Medial olivary nucleus Medial parabrachial nucleus Medial periolivary nuclei Medial vestibular nucleus Median raphe nucleus Middle cingulate cortex Middle frontal gyrus Middle temporal gyrus Motor facial nucleus Motor hypoglossal nucleus Motor trigeminal nucleus Nuclei of the trapezoid body Nucleus accumbens Nucleus ambiguus Nucleus basalis of Meynert Nucleus cuneatus Nucleus gracilis Nucleus of the diagonal band Nucleus raphe magnus Nucleus raphe obscurus Nucleus raphe pallidus Nucleus reuniens Nucleus rhomboideus Nucleus tractus solitarii Occipital cortex Occipital cortex (white matter) Olfactory area Olfactory tubercle Orbitofrontal gyrus, anterior Orbitofrontal gyrus, lateral Orbitofrontal gyrus, medial Orbitofrontal gyrus, posterior Paracentral lobule, anterior Paracentral lobule, posterior Parahippocampal cortex Parahippocampal cortex (white matter) Paramedian reticular nucleus Paraventricular nucleus Parietal cortex Parietal operculum Parieto-insular cortex Parieto-occipital transitional area Parieto-temporal junction (white matter) Parvicellular reticular nuclei Parvicellular reticular nuclei, medullary Pedunculopontine tegmental nucleus Periaquaductal grey, anterior Periaquaductal grey, dorsal Periaquaductal grey, lateral Perirhinal gyrus Peritrigeminal nucleus Piriform cortex Pontine nuclei Pontine raphe nucleus Postcentral gyrus Postcentral gyrus, dorsal Postcentral gyrus, middle Postcentral gyrus, ventral Posterior cingulate cortex Posterior cingulate cortex, dorsal Posterior cingulate cortex, ventral Posterior insular cortex Posterior thalamic nucleus Posteroventral cochlear nucleus Precentral gyrus Precentral gyrus, dorsal Precentral gyrus, middle Precentral gyrus, ventral Precuneus Premotor cortex, dorsal Premotor cortex, ventral Preoptic area Prepositus hypoglossal nucleus Pretectal area Principal sensory trigeminal nucleus Pulvinar Putamen Red nucleus Reticular pontine nucleus, caudal Reticular pontine nucleus, oral Reticulotegmental nucleus Retrosplenial cortex Septal nuclei Somatomor cortex, precentral gyrus (white matter) Somatosensory cortex, postcentral gyrus, ventral (white matter) Spinal trigeminal nucleus, caudal Spinal trigeminal nucleus, interpolar Spinal trigeminal nucleus, oral Spinal vestibular nucleus Stria terminalis, bed nucleus Subcallosal gyrus Subcentral gyrus, S2 Subcoeruleus area Subiculum Substantia nigra Subthalamic nucleus Superior colliculus Superior frontal gyrus Superior olive Superior parietal lobule Superior temporal gyrus Superior vestibular nucleus Supplementary motor cortex Supramarginal gyrus Supraoptic nucleus Temporal cortex Temporal pole Temporal white matter Temporo-insular cortex, parainsular gyrus Temporo-occipital transitional zone Transversal temporal gyrus, anterior Transversal temporal gyrus, posterior Ventral medullary reticular nucleus Ventral periolivary nuclei Ventral posterolateral thalamic nucleus Ventral posteromedial thalamic nucleus Ventral tegmental area Ventral thalamic nuclei Ventrolateral medulla, A1-C1 cell groups Ventrolateral prefrontal cortex Ventrolateral tegmental area, A5 NE cell group Ventromedial nucleus Ventromedial prefrontal cortex Vermis Zona incerta Detected in all Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Pons Spinal cord Thalamus White matter Not detected Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Midbrain Olfactory bulb Pituitary gland Pons and medulla Retina Thalamus White matter Amygdala Caudate putamen Cerebellum Corpus callosum Entorhinal cortex Frontal cortex Hippocampal formation Hypothalamus Midbrain Occipital cortex Olfactory bulb Pituitary gland Pons and medulla Retina Retrosplenial and cingulate cortex Septum Somatosensory cortex Thalamus Ventral forebrain Detected in many Amygdala Basal ganglia Cerebellum Cerebral cortex Hippocampal formation Hypothalamus Medulla oblongata Midbrain Olfactory bulb Pituitary gland Pons Retina Spinal cord Thalamus White matter Amygdala Caudate Cerebellum Cingulate cortex Corpus callosum Dorsal hippocampus Dorsal spinal cord Entorhinal cortex Hypothalamus Insular cortex Medulla oblongata Midbrain Motor cortex Occipital cortex Olfactory bulb Periaqueductal gray Pituitary gland Pons Prefrontal cortex Putamen Retina Retrosplenial cortex Septum Somatosensory cortex Subiculum Substantia nigra Superior colliculi Temporal cortex Thalamus Ventral hippocampus Ventral pallidum Ventral spinal cord Daudi Karpas-707 U-266/70 U-266/84 U-698 Detected in many U-698-M & Daudi - Adaptive immune response A-431 A549 AF22 AN3-CA ASC diff ASC TERT1 BEWO BJ BJ hTERT+ BJ hTERT+ SV40 Large T+ BJ hTERT+ SV40 Large T+ RasG12V CACO-2 CAPAN-2 Daudi EFO-21 FHDF/TERT166 GAMG HaCaT HAP1 HBEC3-KT HBF TERT88 HDLM-2 HEK 293 HEL HeLa Hep G2 HHSteC HL-60 HMC-1 HSkMC HTCEpi HTEC/SVTERT24-B HTERT-HME1 HTERT-RPE1 HUVEC TERT2 JURKAT K-562 Karpas-707 LHCN-M2 MCF7 MOLT-4 NB-4 NTERA-2 OE19 PC-3 REH RH-30 RPMI-8226 RPTEC TERT1 RT4 SCLC-21H SH-SY5Y SiHa SK-BR-3 SK-MEL-30 SuSa T-47d THP-1 TIME U-138 MG U-2 OS U-2197 U-251 MG U-266/70 U-266/84 U-698 U-87 MG U-937 WM-115 memory B-cell naive B-cell Detected in some B-cells - Humoral immune response Basophil Classical monocyte Eosinophil GdT-cell Intermediate monocyte MAIT T-cell Memory B-cell Memory CD4 T-cell Memory CD8 T-cell Myeloid DC Naive B-cell Naive CD4 T-cell Naive CD8 T-cell Neutrophil NK-cell Non-classical monocyte Plasmacytoid DC T-reg Total PBMC B-cells Detected in many Plasma cells Detected in many Plasma cells - Humoral immune response

enhanced Low consistency between antibody staining and RNA expression data Partly consistent with extensive gene/protein characterization data http://images.proteinatlas.org/11193/27220_A_6_8_selected.jpg Adipose tissue Adipocytes low weak >75% cytoplasmic/membranous Male 52 1879 http://images.proteinatlas.org/11193/27284_B_2_8.jpg Female 25 2419 http://images.proteinatlas.org/11193/27284_B_1_7.jpg Female 35 2587 http://images.proteinatlas.org/11193/27284_B_2_7.jpg Male 70 3356 http://images.proteinatlas.org/11193/27284_B_3_7.jpg Adrenal gland Glandular cells low weak 75%-25% cytoplasmic/membranous Female 47 2741 http://images.proteinatlas.org/11193/27284_B_5_5.jpg Female 59 3238 http://images.proteinatlas.org/11193/27284_B_4_5.jpg Male 56 3444 http://images.proteinatlas.org/11193/27284_B_6_5.jpg Appendix Glandular cells low weak 75%-25% cytoplasmic/membranous Lymphoid tissue high strong >75% cytoplasmic/membranous,nuclear Female 77 1896 http://images.proteinatlas.org/11193/27220_A_2_2.jpg Female 20 2444 http://images.proteinatlas.org/11193/27220_A_1_2.jpg Male 52 2761 http://images.proteinatlas.org/11193/27220_A_3_2.jpg Bone marrow Hematopoietic cells medium strong <25% cytoplasmic/membranous,nuclear Male 14 3427 http://images.proteinatlas.org/11193/27284_B_5_4.jpg Female 79 3433 http://images.proteinatlas.org/11193/27284_B_4_4.jpg Female 76 3442 http://images.proteinatlas.org/11193/27284_B_6_4.jpg Breast Adipocytes not detected negative none none Glandular cells not detected negative none none Myoepithelial cells not detected negative none none Female 23 2773 http://images.proteinatlas.org/11193/27284_B_1_4.jpg Female 27 3286 http://images.proteinatlas.org/11193/27284_B_2_4.jpg Bronchus Respiratory epithelial cells not detected negative none none Male 71 2231 http://images.proteinatlas.org/11193/27284_B_4_2.jpg Male 64 2317 http://images.proteinatlas.org/11193/27284_B_6_2.jpg Male 66 3185 http://images.proteinatlas.org/11193/27284_B_5_2.jpg Caudate Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/11193/27284_B_9_7.jpg Female 54 2523 http://images.proteinatlas.org/11193/27284_B_8_7.jpg Female 19 2524 http://images.proteinatlas.org/11193/27284_B_7_7.jpg Cerebellum Cells in granular layer not detected negative none none Cells in molecular layer not detected negative none none Purkinje cells low weak >75% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/11193/27284_B_7_8.jpg Female 54 2523 http://images.proteinatlas.org/11193/27284_B_9_8.jpg Female 19 2524 http://images.proteinatlas.org/11193/27284_B_8_8.jpg Cerebral cortex Endothelial cells high strong >75% cytoplasmic/membranous Glial cells not detected negative none none Neuronal cells not detected weak <25% cytoplasmic/membranous Neuropil not detected negative none none Male 62 1609 http://images.proteinatlas.org/11193/27284_B_8_5.jpg Male 45 2521 http://images.proteinatlas.org/11193/27284_B_7_5.jpg Female 54 2523 http://images.proteinatlas.org/11193/27284_B_9_5.jpg Cervix Glandular cells not detected negative none none Squamous epithelial cells not detected negative none none Female 55 2005 http://images.proteinatlas.org/11193/27284_B_8_3.jpg Female 65 2434 http://images.proteinatlas.org/11193/27284_B_7_3.jpg Female 39 3313 http://images.proteinatlas.org/11193/27284_B_9_3.jpg Colon Endothelial cells high strong >75% cytoplasmic/membranous Glandular cells low weak >75% cytoplasmic/membranous Peripheral nerve/ganglion high strong >75% cytoplasmic/membranous Female 55 1506 http://images.proteinatlas.org/11193/27220_A_7_3.jpg Female 80 2944 http://images.proteinatlas.org/11193/27220_A_9_3.jpg Male 73 3266 http://images.proteinatlas.org/11193/27220_A_8_3.jpg Duodenum Glandular cells low weak >75% cytoplasmic/membranous Male 50 1904 http://images.proteinatlas.org/11193/27220_A_7_2.jpg Male 54 2562 http://images.proteinatlas.org/11193/27220_A_9_2.jpg Female 71 3004 http://images.proteinatlas.org/11193/27220_A_8_2.jpg Endometrium 1 Cells in endometrial stroma low weak 75%-25% cytoplasmic/membranous Glandular cells not detected weak <25% cytoplasmic/membranous Female 42 2242 http://images.proteinatlas.org/11193/27284_B_5_3.jpg Female 33 2941 http://images.proteinatlas.org/11193/27284_B_6_3.jpg Female 35 3333 http://images.proteinatlas.org/11193/27284_B_4_3.jpg Endometrium 2 Cells in endometrial stroma medium moderate 75%-25% cytoplasmic/membranous Glandular cells high strong 75%-25% cytoplasmic/membranous Female 72 1978 http://images.proteinatlas.org/11193/27284_B_2_3.jpg Female 61 3323 http://images.proteinatlas.org/11193/27284_B_1_3.jpg Female 51 3491 http://images.proteinatlas.org/11193/27284_B_3_3.jpg Epididymis Glandular cells not detected negative none none Male 36 1740 http://images.proteinatlas.org/11193/27220_A_3_6.jpg Male 18 2063 http://images.proteinatlas.org/11193/27220_A_2_6.jpg Male 56 3355 http://images.proteinatlas.org/11193/27220_A_1_6.jpg Esophagus Squamous epithelial cells not detected negative none none Female 72 2794 http://images.proteinatlas.org/11193/27284_B_4_1.jpg Male 48 3044 http://images.proteinatlas.org/11193/27284_B_6_1.jpg Male 54 3197 http://images.proteinatlas.org/11193/27284_B_5_1.jpg Fallopian tube Glandular cells not detected negative none none Female 71 1972 http://images.proteinatlas.org/11193/27220_A_7_7.jpg Female 34 2382 http://images.proteinatlas.org/11193/27220_A_8_7.jpg Female 32 2447 http://images.proteinatlas.org/11193/27220_A_9_7.jpg Gallbladder Glandular cells not detected negative none none Female 64 2025 http://images.proteinatlas.org/11193/27220_A_5_4.jpg Female 26 2446 http://images.proteinatlas.org/11193/27220_A_4_4.jpg Male 54 2562 http://images.proteinatlas.org/11193/27220_A_6_4.jpg Heart muscle Cardiomyocytes not detected weak <25% cytoplasmic/membranous Male 45 2521 http://images.proteinatlas.org/11193/27284_B_4_6.jpg Female 54 2523 http://images.proteinatlas.org/11193/27284_B_5_6.jpg Female 19 2524 http://images.proteinatlas.org/11193/27284_B_6_6.jpg Hippocampus Glial cells not detected negative none none Neuronal cells not detected negative none none Male 45 2521 http://images.proteinatlas.org/11193/27284_B_9_6.jpg Female 54 2523 http://images.proteinatlas.org/11193/27284_B_8_6.jpg Female 19 2524 http://images.proteinatlas.org/11193/27284_B_7_6.jpg Kidney Cells in glomeruli high strong 75%-25% cytoplasmic/membranous Cells in tubules low weak 75%-25% cytoplasmic/membranous Male 16 1767 http://images.proteinatlas.org/11193/27220_A_8_5.jpg Female 56 1933 http://images.proteinatlas.org/11193/27220_A_9_5.jpg Male 59 3229 http://images.proteinatlas.org/11193/27220_A_7_5.jpg Liver Cholangiocytes low weak 75%-25% cytoplasmic/membranous Hepatocytes low weak 75%-25% cytoplasmic/membranous Female 32 1846 http://images.proteinatlas.org/11193/27220_A_7_4.jpg Male 55 2429 http://images.proteinatlas.org/11193/27220_A_8_4.jpg Female 63 3222 http://images.proteinatlas.org/11193/27220_A_9_4.jpg Lung Alveolar cells not detected negative none none Macrophages medium moderate >75% cytoplasmic/membranous Male 21 2101 http://images.proteinatlas.org/11193/27220_A_1_4.jpg Male 59 2222 http://images.proteinatlas.org/11193/27220_A_3_4.jpg Female 49 2268 http://images.proteinatlas.org/11193/27220_A_2_4.jpg Lymph node Germinal center cells high strong >75% cytoplasmic/membranous,nuclear Non-germinal center cells medium strong <25% cytoplasmic/membranous Male 63 1638 http://images.proteinatlas.org/11193/27220_A_8_8.jpg Male 55 1724 http://images.proteinatlas.org/11193/27220_A_7_8.jpg Female 53 3285 http://images.proteinatlas.org/11193/27220_A_9_8.jpg Nasopharynx Respiratory epithelial cells not detected negative none none Male 48 2402 http://images.proteinatlas.org/11193/27284_B_8_2.jpg Female 51 2700 http://images.proteinatlas.org/11193/27284_B_9_2.jpg Male 22 3362 http://images.proteinatlas.org/11193/27284_B_7_2.jpg Oral mucosa Squamous epithelial cells not detected negative none none Male 71 1711 http://images.proteinatlas.org/11193/27220_A_9_1.jpg Female 84 2406 http://images.proteinatlas.org/11193/27220_A_8_1.jpg Male 58 3135 http://images.proteinatlas.org/11193/27220_A_7_1.jpg Ovary Follicle cells not detected negative none none Ovarian stroma cells medium strong <25% cytoplasmic/membranous Female 33 2159 http://images.proteinatlas.org/11193/27220_A_4_7.jpg Female 60 2264 http://images.proteinatlas.org/11193/27220_A_5_7.jpg Female 35 2344 http://images.proteinatlas.org/11193/27220_A_6_7.jpg Pancreas Exocrine glandular cells not detected negative none none Pancreatic endocrine cells not detected negative none none Female 35 2032 http://images.proteinatlas.org/11193/27220_A_3_3.jpg Male 66 2329 http://images.proteinatlas.org/11193/27220_A_1_3.jpg Female 70 3320 http://images.proteinatlas.org/11193/27220_A_2_3.jpg Parathyroid gland Glandular cells low weak 75%-25% cytoplasmic/membranous Female 86 3176 http://images.proteinatlas.org/11193/27220_A_2_8.jpg Female 81 3504 http://images.proteinatlas.org/11193/27220_A_3_8.jpg Female 57 3508 http://images.proteinatlas.org/11193/27220_A_1_8.jpg Placenta Decidual cells not detected negative none none Trophoblastic cells not detected weak <25% cytoplasmic/membranous Female 35 1814 http://images.proteinatlas.org/11193/27220_A_2_7.jpg Female 19 2169 http://images.proteinatlas.org/11193/27220_A_1_7.jpg Female 30 2903 http://images.proteinatlas.org/11193/27220_A_3_7.jpg Prostate Glandular cells not detected negative none none Male 51 2053 http://images.proteinatlas.org/11193/27220_A_3_5.jpg Male 60 2098 http://images.proteinatlas.org/11193/27220_A_2_5.jpg Male 76 2932 http://images.proteinatlas.org/11193/27220_A_1_5.jpg Rectum Glandular cells low weak >75% cytoplasmic/membranous Female 66 2060 http://images.proteinatlas.org/11193/27220_A_5_3.jpg Male 44 3231 http://images.proteinatlas.org/11193/27220_A_4_3.jpg Salivary gland Glandular cells not detected negative none none Female 24 2323 http://images.proteinatlas.org/11193/27284_B_1_1.jpg Male 62 2367 http://images.proteinatlas.org/11193/27284_B_2_1.jpg Male 3 2405 http://images.proteinatlas.org/11193/27284_B_3_1.jpg Seminal vesicle Glandular cells not detected negative none none Male 68 3297 http://images.proteinatlas.org/11193/27220_A_8_6.jpg Male 63 3408 http://images.proteinatlas.org/11193/27220_A_9_6.jpg Skeletal muscle Myocytes low weak >75% cytoplasmic/membranous Male 83 2360 http://images.proteinatlas.org/11193/27284_B_2_6.jpg Female 84 2406 http://images.proteinatlas.org/11193/27284_B_1_6.jpg Male 51 2608 http://images.proteinatlas.org/11193/27284_B_3_6.jpg Skin 1 Fibroblasts not detected negative none none Keratinocytes not detected negative none none Langerhans not detected negative none none Melanocytes not detected negative none none Female 17 2426 http://images.proteinatlas.org/11193/27284_B_9_1.jpg Male 16 2549 http://images.proteinatlas.org/11193/27284_B_7_1.jpg Female 41 2956 http://images.proteinatlas.org/11193/27284_B_8_1.jpg Skin 2 Epidermal cells not detected weak <25% cytoplasmic/membranous Female 84 2601 http://images.proteinatlas.org/11193/27284_B_5_8.jpg Male 69 3263 http://images.proteinatlas.org/11193/27284_B_6_8.jpg Small intestine Glandular cells low weak >75% cytoplasmic/membranous Female 51 2467 http://images.proteinatlas.org/11193/27220_A_4_2.jpg Female 56 3343 http://images.proteinatlas.org/11193/27220_A_6_2.jpg Smooth muscle Smooth muscle cells low weak 75%-25% cytoplasmic/membranous Male 16 1767 http://images.proteinatlas.org/11193/27284_B_6_7.jpg Female 33 2175 http://images.proteinatlas.org/11193/27284_B_4_7.jpg Female 65 2434 http://images.proteinatlas.org/11193/27284_B_5_7.jpg Soft tissue 1 Fibroblasts not detected negative none none Peripheral nerve low weak >75% cytoplasmic/membranous Male 52 1879 http://images.proteinatlas.org/11193/27284_B_2_8.jpg Soft tissue 2 Fibroblasts not detected negative none none Peripheral nerve medium moderate >75% cytoplasmic/membranous Female 25 2419 http://images.proteinatlas.org/11193/27284_B_1_7.jpg Female 35 2587 http://images.proteinatlas.org/11193/27284_B_2_7.jpg Male 70 3356 http://images.proteinatlas.org/11193/27284_B_3_7.jpg Spleen Cells in red pulp not detected negative none none Cells in white pulp medium moderate >75% cytoplasmic/membranous Male 72 1714 http://images.proteinatlas.org/11193/27284_B_7_4.jpg Male 36 2940 http://images.proteinatlas.org/11193/27284_B_8_4.jpg Stomach 1 Glandular cells low weak >75% cytoplasmic/membranous Female 56 2130 http://images.proteinatlas.org/11193/27220_A_5_1.jpg Male 68 2471 http://images.proteinatlas.org/11193/27220_A_6_1.jpg Male 72 2583 http://images.proteinatlas.org/11193/27220_A_4_1.jpg Stomach 2 Glandular cells low weak >75% cytoplasmic/membranous Female 75 1534 http://images.proteinatlas.org/11193/27220_A_2_1.jpg Male 71 2411 http://images.proteinatlas.org/11193/27220_A_1_1.jpg Male 52 3315 http://images.proteinatlas.org/11193/27220_A_3_1.jpg Testis Elongated or late spermatids not detected negative none none Leydig cells medium moderate 75%-25% none Pachytene spermatocytes not detected negative none none Peritubular cells not detected negative none none Preleptotene spermatocytes not detected negative none none Round or early spermatids not detected negative none none Sertoli cells medium moderate >75% none Spermatogonia cells not detected negative none none Thyroid gland Glandular cells low weak 75%-25% cytoplasmic/membranous Male 61 2072 http://images.proteinatlas.org/11193/27284_B_2_5.jpg Female 86 2594 http://images.proteinatlas.org/11193/27284_B_1_5.jpg Female 44 3005 http://images.proteinatlas.org/11193/27284_B_3_5.jpg Tonsil Germinal center cells high strong >75% cytoplasmic/membranous,nuclear Non-germinal center cells medium moderate 75%-25% cytoplasmic/membranous Squamous epithelial cells not detected negative none none Male 37 2512 http://images.proteinatlas.org/11193/27220_A_6_8.jpg Male 17 2615 http://images.proteinatlas.org/11193/27220_A_5_8.jpg Female 19 3294 http://images.proteinatlas.org/11193/27220_A_4_8.jpg Urinary bladder Urothelial cells not detected negative none none Male 46 3186 http://images.proteinatlas.org/11193/27220_A_5_5.jpg Female 79 3265 http://images.proteinatlas.org/11193/27220_A_6_5.jpg Male 55 3316 http://images.proteinatlas.org/11193/27220_A_4_5.jpg Vagina Squamous epithelial cells not detected negative none none Female 34 1751 http://images.proteinatlas.org/11193/27284_B_1_2.jpg Female 44 2480 http://images.proteinatlas.org/11193/27284_B_2_2.jpg

Breast cancer Tumor cells low not detected Female 80 1874 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27285_A_6_1.jpg http://images.proteinatlas.org/11193/27285_A_6_2.jpg Female 46 1882 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_4_3.jpg http://images.proteinatlas.org/11193/27285_A_4_4.jpg Female 61 1910 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_6_7.jpg http://images.proteinatlas.org/11193/27285_A_6_8.jpg Female 87 1939 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_6_5.jpg http://images.proteinatlas.org/11193/27285_A_6_6.jpg Female 50 1977 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_5_7.jpg http://images.proteinatlas.org/11193/27285_A_5_8.jpg Female 51 2083 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_4_5.jpg http://images.proteinatlas.org/11193/27285_A_4_6.jpg Female 40 2091 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_4_7.jpg http://images.proteinatlas.org/11193/27285_A_4_8.jpg Female 27 2392 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_6_3.jpg http://images.proteinatlas.org/11193/27285_A_6_4.jpg Female 75 2428 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_5_3.jpg http://images.proteinatlas.org/11193/27285_A_5_4.jpg Female 59 2805 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_5_1.jpg http://images.proteinatlas.org/11193/27285_A_5_2.jpg Female 41 2898 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_4_1.jpg http://images.proteinatlas.org/11193/27285_A_4_2.jpg Female 39 3257 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_5_5.jpg http://images.proteinatlas.org/11193/27285_A_5_6.jpg Carcinoid Tumor cells not detected Male 60 1425 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_1_3.jpg http://images.proteinatlas.org/11193/27218_A_1_4.jpg Female 54 2088 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_1_5.jpg http://images.proteinatlas.org/11193/27218_A_1_6.jpg Male 41 2618 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_1_7.jpg http://images.proteinatlas.org/11193/27218_A_1_8.jpg Male 30 3171 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_1_1.jpg http://images.proteinatlas.org/11193/27218_A_1_2.jpg Cervical cancer Tumor cells low not detected Female 39 1716 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_4_3.jpg http://images.proteinatlas.org/11193/27217_B_4_4.jpg Female 34 1751 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_5_1.jpg http://images.proteinatlas.org/11193/27217_B_5_2.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_4_5.jpg http://images.proteinatlas.org/11193/27217_B_4_6.jpg Female 44 2480 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_5_5.jpg http://images.proteinatlas.org/11193/27217_B_5_6.jpg Female 44 2528 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_6_7.jpg http://images.proteinatlas.org/11193/27217_B_6_8.jpg Female 32 2841 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_4_1.jpg http://images.proteinatlas.org/11193/27217_B_4_2.jpg Female 38 2988 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_6_1.jpg http://images.proteinatlas.org/11193/27217_B_6_2.jpg Female 70 3382 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_6_5.jpg http://images.proteinatlas.org/11193/27217_B_6_6.jpg Female 46 3400 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_5_7.jpg http://images.proteinatlas.org/11193/27217_B_5_8.jpg Female 63 3409 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_5_3.jpg http://images.proteinatlas.org/11193/27217_B_5_4.jpg Female 39 3500 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_6_3.jpg http://images.proteinatlas.org/11193/27217_B_6_4.jpg Colorectal cancer Tumor cells not detected Male 71 1898 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_2_3.jpg http://images.proteinatlas.org/11193/27285_A_2_4.jpg Female 84 1958 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_1_5.jpg http://images.proteinatlas.org/11193/27285_A_1_6.jpg Male 92 2001 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27285_A_2_1.jpg http://images.proteinatlas.org/11193/27285_A_2_2.jpg Female 66 2060 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_3_7.jpg http://images.proteinatlas.org/11193/27285_A_3_8.jpg Male 72 2096 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_3_3.jpg http://images.proteinatlas.org/11193/27285_A_3_4.jpg Female 86 2106 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_1_1.jpg http://images.proteinatlas.org/11193/27285_A_1_2.jpg Female 75 2151 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_3_5.jpg http://images.proteinatlas.org/11193/27285_A_3_6.jpg Female 57 2619 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_2_5.jpg http://images.proteinatlas.org/11193/27285_A_2_6.jpg Male 56 2957 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_2_7.jpg http://images.proteinatlas.org/11193/27285_A_2_8.jpg Male 72 3074 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_1_7.jpg http://images.proteinatlas.org/11193/27285_A_1_8.jpg Female 57 3264 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_3_1.jpg http://images.proteinatlas.org/11193/27285_A_3_2.jpg Male 63 3408 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_1_3.jpg http://images.proteinatlas.org/11193/27285_A_1_4.jpg Endometrial cancer Tumor cells medium low not detected Female 83 1750 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_9_7.jpg http://images.proteinatlas.org/11193/27217_B_9_8.jpg Female 53 1766 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_8_7.jpg http://images.proteinatlas.org/11193/27217_B_8_8.jpg Female 86 1881 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_9_1.jpg http://images.proteinatlas.org/11193/27217_B_9_2.jpg Female 70 2118 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_7_1.jpg http://images.proteinatlas.org/11193/27217_B_7_2.jpg Female 79 2339 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_9_4.jpg Female 58 2455 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_8_1.jpg http://images.proteinatlas.org/11193/27217_B_8_2.jpg Female 81 2607 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_8_5.jpg http://images.proteinatlas.org/11193/27217_B_8_6.jpg Female 58 2621 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_7_7.jpg http://images.proteinatlas.org/11193/27217_B_7_8.jpg Female 63 2772 Medium Strong <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_7_3.jpg http://images.proteinatlas.org/11193/27217_B_7_4.jpg Female 32 3036 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_9_5.jpg http://images.proteinatlas.org/11193/27217_B_9_6.jpg Female 70 3367 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_8_3.jpg http://images.proteinatlas.org/11193/27217_B_8_4.jpg Glioma Tumor cells not detected Male 77 1537 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_5_7.jpg http://images.proteinatlas.org/11193/27218_A_5_8.jpg Female 36 1587 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_4_1.jpg http://images.proteinatlas.org/11193/27218_A_4_2.jpg Male 33 1627 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_6_3.jpg http://images.proteinatlas.org/11193/27218_A_6_4.jpg Female 59 1645 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_6_5.jpg http://images.proteinatlas.org/11193/27218_A_6_6.jpg Female 37 2529 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_5_3.jpg http://images.proteinatlas.org/11193/27218_A_5_4.jpg Male 60 2726 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_6_1.jpg http://images.proteinatlas.org/11193/27218_A_6_2.jpg Male 71 3091 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_6_7.jpg http://images.proteinatlas.org/11193/27218_A_6_8.jpg Male 48 3092 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_5_5.jpg http://images.proteinatlas.org/11193/27218_A_5_6.jpg Male 38 3120 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_4_3.jpg http://images.proteinatlas.org/11193/27218_A_4_4.jpg Male 77 3137 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_4_5.jpg http://images.proteinatlas.org/11193/27218_A_4_6.jpg Female 22 3174 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_5_1.jpg http://images.proteinatlas.org/11193/27218_A_5_2.jpg Female 58 3241 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_4_7.jpg http://images.proteinatlas.org/11193/27218_A_4_8.jpg Head and neck cancer Tumor cells low not detected Female 65 405 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_2_7.jpg Female 55 797 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_2_5.jpg http://images.proteinatlas.org/11193/27218_A_2_6.jpg Male 62 1743 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_2_3.jpg http://images.proteinatlas.org/11193/27218_A_2_4.jpg Male 51 2608 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_2_1.jpg http://images.proteinatlas.org/11193/27218_A_2_2.jpg Liver cancer Tumor cells medium low not detected Female 55 490 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_9_7.jpg http://images.proteinatlas.org/11193/27219_B_9_8.jpg Female 61 555 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_9_5.jpg http://images.proteinatlas.org/11193/27219_B_9_6.jpg Female 65 937 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_7_5.jpg http://images.proteinatlas.org/11193/27219_B_7_6.jpg Female 58 2177 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_8_1.jpg http://images.proteinatlas.org/11193/27219_B_8_2.jpg Female 73 2279 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_7_1.jpg http://images.proteinatlas.org/11193/27219_B_7_2.jpg Male 80 2280 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_9_1.jpg http://images.proteinatlas.org/11193/27219_B_9_2.jpg Female 52 2399 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_8_7.jpg http://images.proteinatlas.org/11193/27219_B_8_8.jpg Male 72 2556 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_9_3.jpg http://images.proteinatlas.org/11193/27219_B_9_4.jpg Male 50 2578 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_8_3.jpg http://images.proteinatlas.org/11193/27219_B_8_4.jpg Female 73 2766 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_7_7.jpg http://images.proteinatlas.org/11193/27219_B_7_8.jpg Male 65 3196 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_8_5.jpg http://images.proteinatlas.org/11193/27219_B_8_6.jpg Female 61 3215 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_7_3.jpg http://images.proteinatlas.org/11193/27219_B_7_4.jpg Lung cancer Tumor cells low not detected Male 57 1428 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_2_3.jpg http://images.proteinatlas.org/11193/27218_B_2_4.jpg Female 63 1765 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_1_7.jpg http://images.proteinatlas.org/11193/27218_B_1_8.jpg Male 64 1847 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_3_5.jpg http://images.proteinatlas.org/11193/27218_B_3_6.jpg Female 51 2041 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_3_1.jpg http://images.proteinatlas.org/11193/27218_B_3_2.jpg Male 66 2050 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_2_5.jpg http://images.proteinatlas.org/11193/27218_B_2_6.jpg Female 47 2100 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_1_5.jpg http://images.proteinatlas.org/11193/27218_B_1_6.jpg Male 59 2222 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_3_7.jpg http://images.proteinatlas.org/11193/27218_B_3_8.jpg Male 71 2231 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_2_7.jpg http://images.proteinatlas.org/11193/27218_B_2_8.jpg Female 65 2403 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_3_3.jpg http://images.proteinatlas.org/11193/27218_B_3_4.jpg Male 49 3003 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_2_1.jpg http://images.proteinatlas.org/11193/27218_B_2_2.jpg Female 73 3016 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_1_3.jpg http://images.proteinatlas.org/11193/27218_B_1_4.jpg Female 70 3391 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_1_1.jpg http://images.proteinatlas.org/11193/27218_B_1_2.jpg Lymphoma Tumor cells high medium low not detected Female 50 1596 Medium Moderate 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_7_7.jpg http://images.proteinatlas.org/11193/27218_A_7_8.jpg Female 36 1606 Medium Strong <25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_7_5.jpg http://images.proteinatlas.org/11193/27218_A_7_6.jpg Female 57 1673 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_7_2.jpg Female 19 1734 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_8_7.jpg http://images.proteinatlas.org/11193/27218_A_8_8.jpg Male 18 2604 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_9_7.jpg http://images.proteinatlas.org/11193/27218_A_9_8.jpg Male 66 2731 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_9_1.jpg http://images.proteinatlas.org/11193/27218_A_9_2.jpg Female 67 2751 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_9_5.jpg http://images.proteinatlas.org/11193/27218_A_9_6.jpg Male 83 2883 Medium Moderate >75% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_8_1.jpg http://images.proteinatlas.org/11193/27218_A_8_2.jpg Female 76 3010 High Strong 75%-25% cytoplasmic/membranous,nuclear http://images.proteinatlas.org/11193/27218_A_8_5.jpg http://images.proteinatlas.org/11193/27218_A_8_6.jpg Female 77 3018 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_7_3.jpg http://images.proteinatlas.org/11193/27218_A_7_4.jpg Male 76 3078 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_8_3.jpg http://images.proteinatlas.org/11193/27218_A_8_4.jpg Male 70 3232 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_9_3.jpg http://images.proteinatlas.org/11193/27218_A_9_4.jpg Melanoma Tumor cells high medium low Male 59 1414 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_6_5.jpg http://images.proteinatlas.org/11193/27218_B_6_6.jpg Male 61 1482 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_6_7.jpg http://images.proteinatlas.org/11193/27218_B_6_8.jpg Male 41 2112 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_5_7.jpg http://images.proteinatlas.org/11193/27218_B_5_8.jpg Female 87 2136 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_4_5.jpg http://images.proteinatlas.org/11193/27218_B_4_6.jpg Male 53 2534 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_4_1.jpg http://images.proteinatlas.org/11193/27218_B_4_2.jpg Female 30 2598 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_5_5.jpg http://images.proteinatlas.org/11193/27218_B_5_6.jpg Female 73 2900 High Strong 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_4_7.jpg http://images.proteinatlas.org/11193/27218_B_4_8.jpg Female 82 3060 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_6_1.jpg http://images.proteinatlas.org/11193/27218_B_6_2.jpg Female 81 3210 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_4_3.jpg http://images.proteinatlas.org/11193/27218_B_4_4.jpg Female 46 3223 High Strong >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_6_3.jpg http://images.proteinatlas.org/11193/27218_B_6_4.jpg Female 64 3260 Medium Moderate 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_5_1.jpg http://images.proteinatlas.org/11193/27218_B_5_2.jpg Ovarian cancer Tumor cells medium low not detected Female 37 857 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_2_7.jpg http://images.proteinatlas.org/11193/27217_B_2_8.jpg Female 73 1844 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_2_3.jpg http://images.proteinatlas.org/11193/27217_B_2_4.jpg Female 51 1911 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_3_5.jpg http://images.proteinatlas.org/11193/27217_B_3_6.jpg Female 57 2082 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_2_1.jpg http://images.proteinatlas.org/11193/27217_B_2_2.jpg Female 59 2347 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_1_1.jpg http://images.proteinatlas.org/11193/27217_B_1_2.jpg Female 69 2391 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_3_7.jpg http://images.proteinatlas.org/11193/27217_B_3_8.jpg Female 62 2568 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_1_3.jpg http://images.proteinatlas.org/11193/27217_B_1_4.jpg Female 80 2747 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_3_4.jpg Female 79 2889 Not detected Negative None none http://images.proteinatlas.org/11193/27217_B_1_5.jpg http://images.proteinatlas.org/11193/27217_B_1_6.jpg Female 56 3115 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_3_1.jpg http://images.proteinatlas.org/11193/27217_B_3_2.jpg Female 44 3146 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_1_7.jpg http://images.proteinatlas.org/11193/27217_B_1_8.jpg Female 61 3323 Medium Moderate >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27217_B_2_5.jpg http://images.proteinatlas.org/11193/27217_B_2_6.jpg Pancreatic cancer Tumor cells low not detected Male 70 729 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_6_1.jpg http://images.proteinatlas.org/11193/27219_B_6_2.jpg Female 70 834 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_5_3.jpg http://images.proteinatlas.org/11193/27219_B_5_4.jpg Female 75 1098 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_6_7.jpg http://images.proteinatlas.org/11193/27219_B_6_8.jpg Male 50 1156 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_6_3.jpg http://images.proteinatlas.org/11193/27219_B_6_4.jpg Male 42 1258 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_5_7.jpg http://images.proteinatlas.org/11193/27219_B_5_8.jpg Male 63 1647 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_4_1.jpg http://images.proteinatlas.org/11193/27219_B_4_2.jpg Male 50 1904 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_6_5.jpg http://images.proteinatlas.org/11193/27219_B_6_6.jpg Female 64 2338 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_5_1.jpg Male 41 2952 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_4_7.jpg Female 71 3004 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_4_3.jpg http://images.proteinatlas.org/11193/27219_B_4_4.jpg Female 56 3233 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_4_5.jpg http://images.proteinatlas.org/11193/27219_B_4_6.jpg Female 78 3363 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_5_5.jpg http://images.proteinatlas.org/11193/27219_B_5_6.jpg Prostate cancer Tumor cells not detected Male 89 2828 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_7_5.jpg http://images.proteinatlas.org/11193/27285_A_7_6.jpg Male 55 3316 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_8_3.jpg http://images.proteinatlas.org/11193/27285_A_8_4.jpg Male 61 3486 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_8_7.jpg http://images.proteinatlas.org/11193/27285_A_8_8.jpg Male 53 3557 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_9_5.jpg http://images.proteinatlas.org/11193/27285_A_9_6.jpg Male 71 3571 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_7_3.jpg http://images.proteinatlas.org/11193/27285_A_7_4.jpg Male 63 3573 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_9_1.jpg http://images.proteinatlas.org/11193/27285_A_9_2.jpg Male 60 3577 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_9_3.jpg http://images.proteinatlas.org/11193/27285_A_9_4.jpg Male 69 3580 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_8_5.jpg http://images.proteinatlas.org/11193/27285_A_8_6.jpg Male 64 3581 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_8_1.jpg Male 60 3586 Not detected Negative None none http://images.proteinatlas.org/11193/27285_A_7_1.jpg http://images.proteinatlas.org/11193/27285_A_7_2.jpg Renal cancer Tumor cells low not detected Female 70 1498 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_7_3.jpg http://images.proteinatlas.org/11193/27219_A_7_4.jpg Female 60 1722 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_7_1.jpg http://images.proteinatlas.org/11193/27219_A_7_2.jpg Male 56 1752 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_8_1.jpg http://images.proteinatlas.org/11193/27219_A_8_2.jpg Male 77 1831 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_8_5.jpg http://images.proteinatlas.org/11193/27219_A_8_6.jpg Female 69 1901 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_9_3.jpg http://images.proteinatlas.org/11193/27219_A_9_4.jpg Male 63 1969 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_9_1.jpg http://images.proteinatlas.org/11193/27219_A_9_2.jpg Female 72 2067 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_7_5.jpg http://images.proteinatlas.org/11193/27219_A_7_6.jpg Male 59 2176 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_7_7.jpg http://images.proteinatlas.org/11193/27219_A_7_8.jpg Male 68 2452 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_8_3.jpg http://images.proteinatlas.org/11193/27219_A_8_4.jpg Male 61 2540 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_9_7.jpg http://images.proteinatlas.org/11193/27219_A_9_8.jpg Female 52 2564 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_8_7.jpg http://images.proteinatlas.org/11193/27219_A_8_8.jpg Female 57 3061 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_9_5.jpg http://images.proteinatlas.org/11193/27219_A_9_6.jpg Skin cancer Tumor cells low not detected Male 24 1693 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_7_1.jpg Male 75 2111 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_7_3.jpg http://images.proteinatlas.org/11193/27218_B_7_4.jpg Male 74 2171 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_9_5.jpg http://images.proteinatlas.org/11193/27218_B_9_6.jpg Female 56 2466 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_8_6.jpg Female 84 2474 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_8_7.jpg http://images.proteinatlas.org/11193/27218_B_8_8.jpg Male 84 3008 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_9_3.jpg http://images.proteinatlas.org/11193/27218_B_9_4.jpg Male 86 3014 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_7_5.jpg http://images.proteinatlas.org/11193/27218_B_7_6.jpg Female 80 3031 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_8_3.jpg http://images.proteinatlas.org/11193/27218_B_8_4.jpg Female 88 3163 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_7_7.jpg http://images.proteinatlas.org/11193/27218_B_7_8.jpg Female 44 3261 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_8_1.jpg http://images.proteinatlas.org/11193/27218_B_8_2.jpg Female 70 3268 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_B_9_1.jpg Male 43 3340 Not detected Negative None none http://images.proteinatlas.org/11193/27218_B_9_7.jpg http://images.proteinatlas.org/11193/27218_B_9_8.jpg Stomach cancer Tumor cells low not detected Male 77 832 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_3_8.jpg Female 71 1061 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_3_3.jpg http://images.proteinatlas.org/11193/27219_B_3_4.jpg Male 82 1787 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_1_2.jpg Male 76 2066 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_1_3.jpg http://images.proteinatlas.org/11193/27219_B_1_4.jpg Male 62 2105 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_1_7.jpg http://images.proteinatlas.org/11193/27219_B_1_8.jpg Male 62 2142 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_B_2_7.jpg http://images.proteinatlas.org/11193/27219_B_2_8.jpg Male 48 2195 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_3_1.jpg http://images.proteinatlas.org/11193/27219_B_3_2.jpg Female 65 2326 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_2_5.jpg http://images.proteinatlas.org/11193/27219_B_2_6.jpg Male 59 2378 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_3_5.jpg http://images.proteinatlas.org/11193/27219_B_3_6.jpg Male 59 2473 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_2_3.jpg http://images.proteinatlas.org/11193/27219_B_2_4.jpg Female 73 2557 Not detected Negative None none http://images.proteinatlas.org/11193/27219_B_1_5.jpg http://images.proteinatlas.org/11193/27219_B_1_6.jpg Testis cancer Tumor cells low not detected Male 52 938 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_3_1.jpg http://images.proteinatlas.org/11193/27219_A_3_2.jpg Male 28 1179 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_3_3.jpg http://images.proteinatlas.org/11193/27219_A_3_4.jpg Male 21 1340 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_1_5.jpg http://images.proteinatlas.org/11193/27219_A_1_6.jpg Male 41 1700 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_3_5.jpg http://images.proteinatlas.org/11193/27219_A_3_6.jpg Male 36 1740 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_1_7.jpg http://images.proteinatlas.org/11193/27219_A_1_8.jpg Male 43 1777 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_2_5.jpg http://images.proteinatlas.org/11193/27219_A_2_6.jpg Male 71 1818 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_2_3.jpg http://images.proteinatlas.org/11193/27219_A_2_4.jpg Male 59 1900 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_2_1.jpg http://images.proteinatlas.org/11193/27219_A_2_2.jpg Male 26 2071 Low Weak 75%-25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_1_3.jpg http://images.proteinatlas.org/11193/27219_A_1_4.jpg Male 19 2116 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_1_2.jpg Male 65 2558 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_2_7.jpg http://images.proteinatlas.org/11193/27219_A_2_8.jpg Male 22 2721 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_3_7.jpg http://images.proteinatlas.org/11193/27219_A_3_8.jpg Thyroid cancer Tumor cells low not detected Male 75 3107 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_3_3.jpg http://images.proteinatlas.org/11193/27218_A_3_4.jpg Female 30 3131 Not detected Negative None none http://images.proteinatlas.org/11193/27218_A_3_7.jpg http://images.proteinatlas.org/11193/27218_A_3_8.jpg Male 33 3267 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27218_A_3_1.jpg http://images.proteinatlas.org/11193/27218_A_3_2.jpg Urothelial cancer Tumor cells low not detected Female 60 1723 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_5_7.jpg http://images.proteinatlas.org/11193/27219_A_5_8.jpg Male 78 1774 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_4_3.jpg http://images.proteinatlas.org/11193/27219_A_4_4.jpg Male 66 1824 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_5_1.jpg http://images.proteinatlas.org/11193/27219_A_5_2.jpg Female 85 1871 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_6_1.jpg http://images.proteinatlas.org/11193/27219_A_6_2.jpg Female 80 2031 Not detected Weak <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_5_3.jpg http://images.proteinatlas.org/11193/27219_A_5_4.jpg Male 51 2053 Low Moderate <25% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_6_7.jpg http://images.proteinatlas.org/11193/27219_A_6_8.jpg Male 35 2311 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_4_5.jpg http://images.proteinatlas.org/11193/27219_A_4_6.jpg Male 78 2469 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_4_7.jpg http://images.proteinatlas.org/11193/27219_A_4_8.jpg Male 77 2802 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_5_5.jpg http://images.proteinatlas.org/11193/27219_A_5_6.jpg Female 64 3002 Low Weak >75% cytoplasmic/membranous http://images.proteinatlas.org/11193/27219_A_6_5.jpg http://images.proteinatlas.org/11193/27219_A_6_6.jpg Female 56 3077 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_6_3.jpg http://images.proteinatlas.org/11193/27219_A_6_4.jpg Female 79 3265 Not detected Negative None none http://images.proteinatlas.org/11193/27219_A_4_1.jpg http://images.proteinatlas.org/11193/27219_A_4_2.jpg Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about/licence